
Springe zum Hauptinhalt
Fakultät für Maschinenbau
Promotion / Habilitation

Promotion und Habilitation

Sehr geehrte Damen und Herren,

vielen Dank für Ihre Interesse an einer Promotion bzw. einer Habilitation an der Fakultät für Maschinenbau der TU Chemnitz. Auf dieser Seite finden Sie alle benötigen Informationen zum Promotionsverfahren. Bei Fragen wenden Sie sich bitte an folgenden Ansprechpartner. Vielen Dank.
Portrait: Kerstin Hensel
Kerstin Hensel
  • Telefon:
    +49 371 531-38074
  • Fax:
    +49 371 531-838074
  • E-Mail:
  • Adresse:
    Reichenhainer Straße 70, 09126 Chemnitz
  • Raum:
    2/A025 (neu: C21.025)


Zunächst müssen Sie für eine Promotion bzw. Habilitation vom Promotionsausschuss zugelassen werden. Hierzu müssen Sie folgende Schritte durchführen:

  1. Anmeldung zur Promotion über unser Online-Formular "Zulassung zur Promotion"
  2. Anschließende Einreichung aller benötigten Unterlagen (gemäß Promotionsordnung §7 (siehe Bereich Downloads)
Nach der Anmeldung über das Online-Formular bekommen Sie eine E-Mail mit der Sie weitere Informationen bekommen.

(Der Promovend hat Bringepflicht - nicht vollständig eingereichte Anträge werden nicht bearbeitet!)

Der Antrag auf Zulassung zur Promotion ist schriftlich an die Vorsitzende des Promotionsausschusses, Frau Prof. Awiszus, der Fakultät zu richten.

Technische Universität Chemnitz
Vorsitzende des Promotionsausschusses
Fakultät für Maschinenbau
09107 Chemnitz

Bei der Beantragung zur Eröffnung eines Promotionsverfahrens (Abgabe der Dissertation) gilt unabhängig von der Ordnung nach der der Promovend zugelassen wurde, §8 der aktuellen Ordnung (siehe Bereich "Downloads").

Hier geht es zu den Grundsätzen zur Sicherung guter wissenschaftlicher Praxis und für das Verhalten bei Verdacht auf wissenschaftliches Fehlverhalten: >>> Klick <<<

Für die Eröffnung von Promotionsverfahren können die entsprechenden vollständigen Unterlagen immer bis zu den Treffen des Promotionsausschusses eingereicht werden, entweder im Büro des Dekans (UT Reichenhainer Str, Raum A025), oder per Post an die Vorsitzende. Eine spätere Annahme ist aus organisatorischen Gründen nicht möglich. Arbeiten oder Dokumente, die nach dem genannten Termin abgegeben werden, können erst in der darauffolgenden Sitzung berücksichtigt werden.

Datum: bis 12.11.19 - Zeit: 14.00 Uhr
Datum: bis 10.12.19 - Zeit: 14.00 Uhr
Datum: bis 28.01.20 - Zeit: 14.00 Uhr

In diesem Zeitfenster können auch andere Fragen betreffs Promotion beantwortet werden.

Promotionsausschuss der Fakultät für Maschinenbau

  • Prof. Dr. Birgit Awiszus (Vorsitz)
  • Prof. Dr. Sophie Gröger
  • Prof. Dr. Alexander Hasse
  • Prof. Dr. Guntram Wagner
  • Prof. Dr. Michael Groß

Verteidigte Promotionen an der Fakultät für Maschinenbau, chronologisch, seit 2003

2019-10-11 Krumm, Dominik
Methodische Aspekte bei der Entwicklung mechanischer Simulation zur Messung der Funktionalitäten eines Handballschuhs
Betreuer: 231035
2019-10-07 Morgenstern, Roy
Anodische Oxidation von kupferhaltigen Aluminiumlegierungen
Betreuer: Prof. Lampke
2019-09-27 Krüger, Dennis
Entwicklung von Systemintegration einer Mikro-Kraft-Wärme-Kopplungs-Anlage für feste Biomasse
Betreuer: Prof. Platzer
2019-09-26 Roudini, Mehrzad
Experimental Investigation of Spray Characteristics of Prefilming Airblast Atomizers
Betreuer: Prof. Wozniak
2019-09-16 Kirchner, Philipp
Fördertechnisches Gesamtsystem für eine automatisierte und flexible Fahrzeug-Fertigung
Betreuer: Prof. Nendel
2019-09-13 Silbermann, Christian
Modellierung versetzungs- und verformungsinduzierter plastischer Lokalisierungsphänomene
Betreuer: Prof. Ihlemann
2019-08-29 Choudry, Saphir Ahmad
Multidimensionale Bewertung von Fügetechnologien-Entwicklung einer Auswahlmethodik zur optimierten Entscheidungsfindung im Karosseriebau
Betreuer: Prof. Drossel
2019-08-23 Kirbach, Carola
Untersuchungen zum mechanischen Verhalten von Aluminium/Magnesium-Werkstoffverbunden und deren Grenzschicht bei der weiteren Umformung
Betreuer: Prof. Ihlemann
2019-08-22 Schleicher, Tim
Gestaltung gebrauchstauglicher Mensch-Roboter-Schnittstellen für den Einsatz in einer instruktiven Mensch-Roboter-Kollaboration in der variantenreichen Serienproduktion am Beispiel eines Polierroboters in der Automobilbranche
Betreuer: Prof. Bullinger-Hoffmann
2019-08-21 Cramer, Kay
Technologie zur ortsnahen und energieeffizienten Suspensionsherstellung unter Verwendung von Stützkorn zum dauerhaften Bergversatz
Betreuer: Prof. Nendel
2019-07-19 Dettmann, André
Eignung autostereoskopischer Displays im Fahrzeugkontext unter Einbeziehung von Ergonomie und Wahrnehmungsleistung
Betreuer: Prof. Bullinger-Hoffmann
2019-07-15 Büttner, Rebekka
Entwicklung eines Modells zur Steigerung der Wandlungsfähigkeit produzierender Unternehmen vor dem Hintergrund der Digitalisierung am Beispiel des Automobilbaus
Betreuer: Prof. Müller
2019-07-01 Wieczorek, geb.Schubach, Katrin
Die Entwicklung eines Verfahrens zur Rekonstruktion informationstechnologie-getriebener Veränderungsprozesse in Unternehmen mittels Aufbereitung heterogener Datenquellen, am Beispiel von ERP-Implementationen in KMU
Betreuer: Prof. Müller
2019-06-28 Hahn, Thomas
Optimierung der Rekuperationsfähigkeit elektrifizierter Fahrzeugantriebe
Betreuer: Prof. v. Unwerth
2019-06-18 Bali, Chadha
Coffee-ring-effect based self-assembly mechanism for the realization of all-inkjet printed organic field effect transistors with micron-sized channel length
Betreuer: Prof. Hübler
2019-06-14 Pavlicek, Florentina
Parametrierbare Metamodelle zur Berechnung des Wärmeübergangs in Hohlräumen (online verfügbar)
Betreuer: Prof. Neugebauer
2019-05-28 Stoldt, Johannes
Gestaltungsmethodik für Simulationsstudien in Umplanungsprojekten zur Energieeffizienzsteigerung in Fabriken (online verfügbar)
Betreuer: Prof. Putz
2019-05-28 Mwangi, James Wamai
Analysis and Optimization of Electrical Discharge machining of Nitinol Shape Memory Alloys (online verfügbar)
Betreuer: Prof. Schubert
2019-05-24 Weisbach, Tobias
Versagensanalyse und Lebensdauerevaluation von kurvengängigen Kunststoffketten (online verfügbar)
Betreuer: Prof. Nendel
2019-05-24 Weißgerber, Marco
Bestimmung der spezifischen, oberflächenbedingten Scanning-Antastabweichungen für taktile 3D-Koordinatenmessgeräte (online verfügbar)
Betreuer: Prof. Gröger
2019-05-10 Philipp, André
Steigerung der Effizienz und Leuchtdichtehomogenität von organischen Leuchtdioden mittels Druck- und Laserprozessen (online verfügbar)
Betreuer: Prof. Baumann
2019-05-08 Herfert, Heike
Untersuchungen zum Wärme- und Feuchtetransportmanagement von Abstandsgewirken für Bettwaren (online verfügbar)
Betreuer: Prof. Nendel
2019-04-26 Leistner, Bastian
Fahrwerksentwicklung und produktionstechnische Integration ab der frühen Produktentstehungsphase
Betreuer: Prof. Mayer
2019-04-18 Zhao, Pengcheng
Development and investigation of bio-based environmentally freindly fire retardant PLA composites (online verfügbar)
Betreuer: Prof. Gehde
2019-04-02 Hirsch, Michael
Analyse der systematischen Geometrieabweichung beim Profilquerwalzen von Schneckenprofilen
Betreuer: Prof. Awiszus
2019-03-13 Ballmann, Markus
Hochtemperaturfähiges Übertragungselement für elastische Wellenkupplungen (online verfügbar)
Betreuer: Prof. Nendel
2019-03-12 Sayouf , Mohamad Anis
Simulation thermischer Kurzzeit-Multi-Speichersysteme (online verfügbar)
Betreuer: Prof. Platzer
2019-03-01 Nguyen Dang, Tan
Entwicklung eines effizienten Montageplanungssystems auf Basis von Funktionsfolgen
Betreuer: Prof. Berger
2019-02-22 Kunze, Thomas
Bewertung von repetitiven Tätigkeiten mit dem Ergonomic Assessment Worksheet (EAWS) in der Automobilindustrie – Validierung der EAWS-Sektion 4 und Entwicklung eines Grobscreenings zur Vorprüfung der Anwendung von EAWS-Sektion 4
Betreuer: Prof. Bullinger-Hoffmann
2019-02-22 Vogel, Veronika
Entwicklung von Prozess- und Werkzeugtechnik für funktionsintegrierte Leichtbaustrukturen aus endlos -faserverstärkten Kunststoffen
Betreuer: Prof. Gehde
2019-02-06 Schmidt, Elisabeth
Wirkung von thermischer Stimulation während passiver Fahrermüdigkeit
Betreuer: Prof. Bullinger-Hoffmann
2019-02-04 Pfeiffer, Steffen
Mikromechanische Modellbildung und FE-Simulationen zur elastischen Anisotropie von verzwillingten NiTi-Martensiten (online verfügbar)
Betreuer: Prof. Wagner, M.
2019-01-14 Pierschel, Norbert
Werkzeugtechnik und Prozess zur Herstellung pressgehärteter Bauteile mit kleinflächig gradierten Eigenschaften (online verfügbar)
Betreuer: Prof. Landgrebe
2018-12-20 Dr. Hansal , Wolfgang
Elektrochemische Pulsabscheidung (online verfügbar)
Betreuer: Prof. Lampke
2018-12-20 Schierz, Mario
Steigerung des elastischen Potenzials von Pressverbindungen durch plastische Konditionierung der Fügepartner
Betreuer: Prof. Leidich
2018-12-11 Roth, Tobias
Ermittlung von Kennwerten von einfachwirkenden Umformmaschinen für die zustandsorientierte Instandhaltung und die Qualifizierung des Werkzeugentstehungsprozesses (online verfügbar)
Betreuer: Prof. Neugebauer
2018-12-06 Al-Mashhadani, Hayder Ibrahim Saleh
Refractory metals low temperature dissufion bonding (online verfügbar)
Betreuer: Prof. Mayr
2018-11-23 Kielhorn, Christoph
Zustandsorientierte Instandhaltung auf Energiedatenbasis in der Automobilproduktion (online verfügbar)
Betreuer: Prof. Müller
2018-11-22 Nitsche, Alexander
Metallurgische Erstarrungs-Phänomene bei warmfesten 9%Cr-Schweißzusatzwerkstoffen und deren Auswirkungen auf die Schweißguteigenschaften
Betreuer: Prof. Mayr
2018-11-14 Grätzl, Thomas Lorenz
Einfluss der automobilen Lackierprozesse auf thermoplastische Strukturbauteile mit Endlosfaserverstärkung (online verfügbar)
Betreuer: Prof. Kroll
2018-11-12 Bauer, Ruben
Modellbasierte Auslegung von Mehrschnittstrategien beim Wälzschälen
Betreuer: Prof. Neugebauer
2018-11-02 Heuer, Georg
Development of an operation strategy for electrified auxiliaries on the power train of conventional vehicles (online verfügbar)
Betreuer: Prof. von Unwerth
2018-10-22 El-Araby Megahed Ali, Ibrahim
Oxidationsverhalten von Wärmedammschichtsystemen mit Al-Zwischenschichten (online verfügbar)
Betreuer: Prof. Lampke
2018-10-12 Scheffler, Thomas
Werkstoffeinflüsse auf den Spritzgussprozess bei Phenol-Formaldehydharz-Formmassen (online verfügbar)
Betreuer: Prof. Gehde
2018-10-12 Wagensoner, Matthias
Automatisierte Bewertung von Blistern zur Optimierung der Gesamtprozesskette Aluminium-Strukturbauteile (online verfügbar)
Betreuer: Prof. Gröger
2018-10-01 Heinrich, Stefan
Modulbasierte Synthese ebener Koppelgetriebe unter Einbeziehung kinetischer Kenngrößen (online verfügbar)
Betreuer: Prof. Berger
2018-09-26 Buhl, Marcus
Analyse von Strömungseffekten in Schichtenladersystemen (online verfügbar)
Betreuer: Prof. Platzer
2018-09-11 Schönherr, Julia
Methode zur techno-energetischen Bilanzierung von Fertigungsprozessketten am Beispiel Presshärten (online verfügbar)
Betreuer: Prof. Neugebauer
2018-09-05 Schmitt, Carsten
Beitrag zur Prädiktion von Schalltransferpfaden in Fahrzeuggetrieben (online verfügbar)
Betreuer: Prof. Drossel
2018-09-03 Pagel, Kenny
Entwicklung von Formgedächtnisaktoren mit Inhärenter Führungsfunktion (online verfügbar)
Betreuer: Prof. Drossel
2018-09-03 Müller, Peter
Analyse elastischer Wechselwirkungen an Servo-Spindelpressen (online verfügbar)
Betreuer: Prof. Drossel
2018-08-28 Opitz, Tobias
Vermeidungsstrategien fluiddynamischer Effekte beim Einsatz von Schnellerwärmungstechnologien in der Warmumformung (online verfügbar)
Betreuer: Prof. Drossel
2018-08-23 Börner, Kerstin
Die Altersabhängigkeit der Beanspruchung von Montagemitarbeitern - eine Feldstudie in der Automobilindustrie (online verfügbar)
Betreuer: Prof. Bullinger-Hoffmann
2018-08-13 Kyosev, Yordan
Topologiebasierte Modellierung von Textilstrukturen und deren Produkte - Prinzipien, Algorithmen und Grenzen (online verfügbar)
Betreuer: Prof. Cebulla
2018-08-09 Seung, Taehun
Holistic-Light-Weight Approach for actuation systems of the next generation aircraft (online verfügbar)
Betreuer: Prof. Kroll
2018-08-09 Goldberg, Niels
Homogenisierung und Modellierung des Materialverhaltens kurzfaserverstärkter Thermoplaste (online verfügbar)
Betreuer: Prof. Ihlemann
2018-08-07 Al-Obaidi, Amar Baker Salim
Induktionsgestützte Inkrementelle Blechumformung von hochfesten Stahlwerkstoffen (online verfügbar)
Betreuer: Prof. Landgrebe
2018-07-31 Hofbauer, Daniel
Multikriterielle Entscheidungsanalyse und Bauweisenvergleich von Faserverbundtechnologien für die Herstellung von Leichtbau-Karosseriestrukturen (online verfügbar)
Betreuer: Prof. Kroll
2018-07-24 John, Björn
Verwendung instationärer Gasströme in der Lasertechnik (online verfügbar)
Betreuer: Prof. Mayr
2018-07-18 Lindner, Thomas
Verfahrenskombinationen zur Randschichthärtung thermisch gespritzter Schichtsysteme aus austenitischem Stahl (online verfügbar)
Betreuer: Prof. Lampke
2018-07-10 Regel, Joachim
Bewertung konstruktiver und kompensatorischer Maßnahmen zur thermo-sensitiven Auslegung von Werkzeugmaschinenstrukturen (online verfügbar)
Betreuer: Prof. Neugebauer
2018-07-03 Streb, Fabian
Novel materials for heat dissipation in semiconductor technologies (online verfügbar)
Betreuer: Prof. Lampke
2018-06-29 Heinrich, Michael
In-situ-Prozesse zur Kontaktierung und Verbindung piezokeramischer Module neuer Generation (online verfügbar)
Betreuer: Prof. Kroll
2018-06-21 Keller, Carsten
Verfahren zur automatisierten Shim-Maß-Berechnung am Beispiel von Karosseriebauspannvorrichtungen (online verfügbar)
Betreuer: Prof. Putz
2018-06-20 Parodi, Jaime Alejandro Puentes
Adhesion of Polyurethane-Steel Hybrids and Influence of Annealing on its Durability and Lifetime (online verfügbar)
Betreuer: Prof. Gehde
2018-05-04 Maenz, Torsten
Spritzgießtechnische Herstellung duroplastgebundener Dauermagnete (online verfügbar)
Betreuer: Prof. Gehde
2018-04-19 Regensburger, Jochen
Nichtlineares Deformationsverhalten von Karosserie-Außenhautbauteilen aus Aluminium im Lacktrocknungsprozess (online verfügbar)
Betreuer: Prof. Drossel
2018-04-16 Meichsner, Gunnar
Entwicklung und Realisierung einer Methode zur Bestimmung von Prozesseingangsgrößen für das elektrochemische Präzisionsabtragen (online verfügbar)
Betreuer: Prof. Schubert
2018-04-13 Strobel, Jens
Untersuchung von Schwingungen an einem Stetigfördersystem mit Kunststoffgleitketten (online verfügbar)
Betreuer: Prof. Nendel
2018-03-28 Findeisen, Fabian
Radiale Diffusoren in Warmwasserspeichern - Einfluss des Beladesystems auf Strömungsverhalten und Schichtungsqualität (online verfügbar)
Betreuer: Prof. Platzer
2018-03-27 Uhlig, Thomas
Neuartige Co-Basislote zum Hochtemperaturlöten thermisch stark belasteter Bauteile (online verfügbar)
Betreuer: Prof. Wagner, G.
2018-03-16 Tästensen, Robert
Integrierte Methode zur objektiven Bewertung von Equipmentfehlern in der Instandhaltung und rationellen Investitionsplanung (SEAFIP) (online verfügbar)
Betreuer: Prof. Müller
2018-02-23 Winkler, Ruben
Haftmechanismen von Metallen (Cu, Al) appliziert durch Draht-Lichtbogenspritzen auf Polymeroberflächen (PEEK) (online verfügbar)
Betreuer: Prof. Lampke
2018-02-23 Hartung, Ingmar
Fahrzeugnahe Methoden zur Diagnose von Degradationsvorgängen an automobilen PEM-Brennstoffzellen-Aggregaten (online verfügbar)
Betreuer: Prof. von Unwerth
2018-02-20 Elibol, Cagatay
Lokalisierungs- und Relaxationsphänomene in pseudoelastischen und martensitischen NiTi-Formgedächtnislegierungen (online verfügbar)
Betreuer: Prof. Wagner
2018-02-12 Simon, Katharina
Erfassung des subjektiven Erlebens jünger und älterer Autofahrer zur Ableitung von Unterstützungsbedürfnissen im Fahralltag (online verfügbar)
Betreuer: Spanner-Ulmer
2018-01-24 Siebeck, Steve
Pulvermetallurgische Synthese von Aluminiummatrix-Verbundwerkstoffen durch Hochenergiemahlen (online verfügbar)
Betreuer: Prof. Wagner, G.
2018-01-22 Qin, Renhang
Dynamische Simulation des Verhaltens von Gasen in Heizungsanlagen (online verfügbar)
Betreuer: Prof. Platzer
2018-01-19 Weiß, Frederik
Methodik zur optimalen Konzeptauslegung elektrifizierter Fahrzeugantriebe (online verfügbar)
Betreuer: Prof. von Unwerth
2017-12-20 Wächter, Michael
Engineering-Methode zur Gestaltung gebrauchstauglicher tangibler Mensch-Maschine-Schnittstellen für Planer und Entwickler von Produktionsassistenzsystemen (online verfügbar)
Betreuer: Prof. Bullinger-Hoffmann
2017-12-18 Kaiser, André
Modellierung maximaler menschlicher Muskelmomente auf Basis digitaler Menschmodelle - am Beispiel der oberen Extremitäten (online verfügbar)
Betreuer: Prof. Bullinger-Hoffmann
2017-12-04 Ringleb, Ansgar
Numerische und experimentelle Untersuchung der fluiddynamischen Eigenschaften von Strahlströmungen in begrenzten Räumen (online verfügbar)
Betreuer: Prof. Wozniak
2017-11-21 Kleicke, Roland
Analyse und Optimierung der Webtechnik zur Realisierung von textilen Halbzeugen mit gestreckten Fadenlagen für die Faserverbundwerkstoffe (online verfügbar)
Betreuer: Prof. Cebulla
2017-11-16 Winter, Sven
Mikrostrukturelle Einflussparameter auf die adiabatische Scherbandbildung in einer metastabilen ?-Titanlegierung
Betreuer: Prof. Wagner
2017-11-13 Steinert, Philipp
Fertigung und Bewertung deterministischer Oberflächenmikrostrukturen zur Beeinflussung des tribologischen Verhaltens von Stahl-Bronze-Gleitpaarungen (online verfügbar)
Betreuer: Prof. Schubert
2017-11-02 Härtel, Markus
Werkstoffmechanischer und mikrostruktureller Vergleich von uniaxialen und biaxialen Bauschinger-Effekten im Blechwerkstoff DC06im Blechwerkstoff DC06 (online verfügbar)
Betreuer: Prof. Wagner, M.
2017-10-20 Rosen, Philipp
Beitrag zur thermischen und geometrischen Optimierung von Wasserstoffdruckbehältern für die automobile Anwendung (online verfügbar)
Betreuer: Prof. von Unvwerth
2017-10-12 Bräunig, Jan
Entwicklung und Verifizierung eines Berechnungsmodells zur Anregungsprognose von Verzahnungen unter Berücksichtigung des anisotropen Materialverhaltens (online verfügbar)
Betreuer: Prof. Neugebauer
2017-10-10 Dietz, Ronald
Strukturbezogene Betrachtung zum Zeitstandverhalten geschweißter Polyolefinhalbzeuge - Morphologie und Bruchverhalten (online verfügbar)
Betreuer: Prof. Gehde
2017-09-19 Dallinger, Niels
Die Diskrete Elemente Methode in der Vibrationsfördertechnik (online verfügbar)
Betreuer: Prof. Nendel
2017-09-18 Putzke, Enrico
Charakteristik und Verhalten von synthetischen Faserstoffen in homogenen und heterogenen Wirkpaarungen (online verfügbar)
Betreuer: Prof. Nendel
2017-09-12 Bartsch, Ralf
Erweiterung der Dimensionierungsgrundlagen für Gleitkettensysteme (online verfügbar)
Betreuer: Prof. Nendel
2017-09-11 Drehmann, Rico
Haftmechanismen kaltgasgespritzter Aluminiumschichten auf keramischen Oberflächen (online verfügbar)
Betreuer: Prof. Lampke
2017-09-08 Donner, Hendrik
FEM-basierte Modellierung von Hybridcorden und Hybridcord-Elastomer-Verbunden (online verfügbar)
Betreuer: Ihlemann
2017-09-05 Irmscher, Susann
Neues Programmmodell für das Pulsschweißen (online verfügbar)
Betreuer: Prof. Matthes
2017-08-24 Todt, Andreas
Beitrag zur Entwicklung neuartiger hybrider Werkstoffverbunde auf Keramik/Polymer-Basis (online verfügbar)
Betreuer: Prof.Wagner, G.
2017-08-09 Weil, Christoph
Technologische Wirkzusammenhänge des kontinuierlichen Widerstands-Pressschweißens mit umschließendem Induktor
Betreuer: Prof. Landgrebe
2017-08-07 Zillmann, Benjamin
Fließspannungsermittlung an Feinblechen unter ebener biaxialer Druckbelastung (online verfügbar)
Betreuer: Prof. Lampke
2017-07-20 Hielscher, Holger
Entwicklung einer Hochleistungsultraschalleinheit mit hohen Schwingungsamplituden (online verfügbar)
Betreuer: Prof. Neugebauer
2017-07-20 Hecht, Benjamin
Vorhersage und Bewertung der Qualitätskriterien rollgefalzter Karosserieanbauteile (online verfügbar)
Betreuer: Prof. Neugebauer
2017-07-17 Hoffmann, Uwe
Kennzahlenbasierte Entscheidungsunterstützung für die aggregierte Produktionsprogrammplanung (online verfügbar)
Betreuer: Prof. Müller
2017-06-22 Quade, Michael
Methodik zur Entwicklung eines Baukastens für wandlungsfähige Produktionsmittel
Betreuer: Prof. Müller
2017-06-12 Raschke, Kristin
Grundlagenuntersuchungen zur Prozess- und Struktursimulation von Phenolharzformmassen mit Kurz- und Langglasfaserverstärkung (online verfügbar)
Betreuer: Prof. Gehde
2017-06-09 Sowade, Enrico
Selbstorganisationsphänomene nanoskopischer Materialien im Inkjetdruck (online verfügbar)
Betreuer: Prof. Baumann
2017-06-08 Michna, Gregor
Planungsmodell für die montagegerechte Produktbeeinflussung in der Produktentstehungsphase eines Automobilherstellers (online verfügbar)
Betreuer: Prof. Müller
2017-06-07 Kaars, Jonny
Zur Thermomechanik des Widerstandspunktschweißens von Vergütungsstahl am Blechstoß mit Spalt (online verfügbar)
Betreuer: Prof. Mayr
2017-05-19 Hoppe, Thomas
Thermodynamische Analyse von Konzepten zur Energierückgewinnung aus Wasserstoffspeichern für PEM-Brennstoffzellensysteme (online verfügbar)
Betreuer: Prof. von Unwerth
2017-05-11 Mehner, Thomas
Zusammenhänge zwischen Werkstoff- und Oberflächenzustand und der Korrosionsanfälligkeit von Metallen (online verfügbar)
Betreuer: Prof. Lampke
2017-05-05 Küchler, Pierre
Fahrzeugnahe Kühlungsrandbedingungen von Abgassystemen an Motorprüfständen
Betreuer: Prof. Platzer
2017-05-05 Konarsky, Michael
Entwicklung eines IT-gestützten Kosteninformations-Systems als Instrument des Produktkostenmanagements in der Auftragsfertigung (online verfügbar)
Betreuer: Prof. Leidich
2017-04-28 Arnold, Roman
Entwicklung eines Modells zur Bewertung der Qualität der Digitalen Fabrik am Beispiel der Automobilindustrie (online verfügbar)
Betreuer: Prof. Müller
2017-04-21 Sacher, Patrick
Rückfederungsreduzierung durch simulationsbasierte Methodenoptimierung in der Blechumformung (online verfügbar)
Betreuer: Prof. Awiszus
2017-03-31 Meyer, Daniel
Korrelation zwischen Herstellungsprozess, Struktur und Eigenschaften von anodischen Aluminiumoxidschichten für Verschleißschutzanwendungen (online verfügbar)
Betreuer: Prof. Lampke
2017-02-23 Hipp, Kevin
Einsatz hybrider Optimierungsverfahren zur Inbetriebnahme elektromechanischer Systeme
Betreuer: Prof. Neugebauer
2017-02-20 Schulze, Karola
Adhäsions- und Degradationsverhalten an der Grenzfläche zwischen Titan und Polyetheretherketon (online verfügbar)
Betreuer: Prof. Wielage
2017-02-14 Ulke-Winter, Lars
Naturanaloge Optimierungsverfahren zur Auslegung von Faserverbundstrukturen (online verfügbar)
Betreuer: Prof. Kroll
2017-02-13 Krones, Manuela
A Method to Identify Energy Efficient Measures for Factory Systems Based on Qualitative Modeling (online verfügbar)
Betreuer: Prof. Müller
2017-01-26 Podlesak, Frank
Entwicklung und Verifizierung eines vorlochfreien mechanischen Fügeverfahrens zum Verbinden von Leichtmetallen und Faser-Kunststoff-Verbunden (online verfügbar)
Betreuer: Prof. Mayr
2017-01-18 Fritsch, Sebastian
Einfluss von Tieftemperaturumformungen auf das Werkstoffverhalten einer hochfesten AlZnMgCu-Legierung (online verfügbar)
Betreuer: Prof. Wagner, M.
2017-01-10 Jäckel, Mathias
Erweiterung der Prozessgrenzen für das Halbhohlstanznieten durch den Einsatz geteilter Matrizenwerkzeuge
Betreuer: Prof. Landgrebe
2016-12-21 Krauß, Alexander
Optimierte Sickengestaltung im Konstruktionsprozess dünnwandiger Bauteile (online verfügbar)
Betreuer: Prof. Leidich
2016-12-21 Sieber, Maximilian
Elektrochemisches Modell zur Beschreibung der Konversion von Aluminium durch anodische Oxidation (online verfügbar)
Betreuer: Prof. Lampke
2016-12-19 Krüger, David
Auslegungsgrenzen, Grübchen- und Zahnfußtragfähigkeit asymmetrischer Stirnradverzahnungen (online verfügbar)
Betreuer: Prof. Leidich
2016-12-16 Rautenstrauch, Anja
Methodik zur Prozessauslegung anforderungsgerecht gestalteter Strukturbauteile im Automobilbau (online verfügbar)
Betreuer: Prof. Neugebauer
2016-12-06 Vibrans, Tobias
Induktive Erwärmung von Formplatinen für die Warmumformung (online verfügbar)
Betreuer: Prof. Drossel
2016-11-11 Danzer, Christoph
Systematische Synthese, Variation, Simulation und Bewertung von Mehrgang- und Mehrantrieb-Systemen rein elektrischer und hybrider Fahrzeugantriebe (online verfügbar)
Betreuer: Prof. von Unwerth
2016-11-10 Gelbrich, Sandra
Funktionsintegrative Leichtbaustrukturen für Tragwerke im Bauwesen (online verfügbar)
Betreuer: Prof. Kroll
2016-11-02 Naumann, Christoph
Chemisch-mechanisch gekoppelte Modellierung und Simulation oxidativer Alterungsvorgänge in Gummibauteilen (online verfügbar)
Betreuer: Prof. Ihlemann
2016-10-26 Özdeniz, Eyüp Akin
Entwicklung korrosions- und verschleißbeständiger thermisch gespritzter Zylinderlaufbahnen für Verbrennungsmotoren (online verfügbar)
Betreuer: Prof. Lampke
2016-10-21 Siengchin, Suchart
Naturfaserverstärkte Thermoplaste (Natural Fiber Reinforced Thermplastics) (online verfügbar)
Betreuer: Prof. Kroll
2016-10-07 Kalinowska, Agnieszka
Wissenschaftlich-technischer Beitrag zum prozessintegrierten Bedrucken von Kunststoffteilen während des Spritzgießens
Betreuer: Prof. Gehde
2016-09-28 Sadeghi, Amir
Microstructure evolution and strengthening mechanism in Ni-based composite coatings (online verfügbar)
Betreuer: Prof. Lampke
2016-08-30 Alaluss, Khaled Ahmed
Modellbildung - Simulation des Plasma-Schweißens zur Entwicklung innovativer Schweißbrenner (online verfügbar)
Betreuer: Prof. Matthes
2016-08-19 Hofmann, Stefan
Untersuchungen zur Ermüdungsfestigkeit von Pressverbindungen (online verfügbar)
Betreuer: Prof. Leidich
2016-08-18 Gerstmann, Thoralf
Erweiterung der Verfahrensgrenzen desn Flach-Clinchens (online verfügbar)
Betreuer: Prof. Awiszus
2016-08-02 Kretschmer, Andreas
Einflussfaktoren auf die Lebensdauer laufender Faserseile
Betreuer: Prof. Nendel
2016-07-12 Pflugradt, Noah
Modellierung von Wasser- und energieverbräuchen in Haushalten (online verfügbar)
Betreuer: Prof. Platzer
2016-07-01 Müller, Sascha
Kerbfestigkeitsanalyse nietgefügter Faserverbund- und Metallkomponenten unter Berücksichtigung richtungsabhängiger lokaler Versagensmechansimen
Betreuer: Prof. Kroll
2016-07-01 Hammerschmidt, Jens
Inkjet-based manufacture and mechanical reinforsement of microsieves (Inkjekt-basierte Herstellung und mechanische Stabilisierung von Mikrosieben) (online verfügbar)
Betreuer: Prof. Baumann
2016-06-27 Schlutter, Ruben
Ermittlung von Korrekturfaktoren zur Verbesserung der Qualität des Druckes von Spritzgießsimulationen
Betreuer: Prof. Gehde
2016-05-20 Maaß, geb. Leck, Lena
Strategische Einbindung der Umformsimulation in die Entwicklungsprozesskette Karosserie (online verfügbar)
Betreuer: Prof. Awiszus
2016-05-20 Wulf, Hans
Modellierung und Simulation von Selbstorganisationsprozessen in belasteten technischen Gummiwerkstoffen (online verfügbar)
Betreuer: Prof. Ihlemann
2016-05-02 Lamprecht, Andreas
Energieprädiktion und Reichweitendarstellung durch Navigationsdaten im Kraftfahrzeug (online verfügbar)
Betreuer: Prof. Mayer
2016-04-29 Vidner, Jakub
Methode zur Bewertung der Ermüdungsfestigkeit von reibdauerbeanspruchten Systemen
Betreuer: Prof. Leidich
2016-04-22 Bleesen, Christoph
Neue Verfahrenstechnologien und funktionelle Oberflächen zur gezielten Manipulation der tribologischen Eigenschaften von Bauteilen aus Kunststoffen (online verfügbar)
Betreuer: Prof. Nendel
2016-04-08 Klauke, Rainer
Lebensdauervorhersage mehrachsig belasteter Elastomerbauteile unter besonderer Berücksichtigung rotierender Beanspruchungsrichtungen (online verfügbar)
Betreuer: Prof. Ihlemann
2016-04-01 Nestler, Matthias
Umformung metallbasierter Mehrschichtverbunde mit Sensor- und Aktorfunktionalität
Betreuer: Prof. Neugebauer
2016-03-31 Hensel, Sebastian
Numerisch-simulative Modellbildung für die Entwicklung von Technolgien zur Herstellung von Piezo-Metall-Verbunden und deren Charakterisierung
Betreuer: Prof. Neugebauer
2016-03-31 Rehm, Matthias
Analyse mechanisch gekoppelter, gegenläufig verfahrender Direktantriebe und ihre Einordnung mittels prozessorientierter Entwicklungsmethodik
Betreuer: Prof. Neugebauer
2016-03-24 Stock, Timo
Gestaltung energieeffizienter Wertschöpfungsketten mittels modifizierter Wertstromanalyse
Betreuer: Prof. Müller
2016-03-04 Denninger, Daniel
Prozessorientierte Synthesemethodik am Beispiel der neuartigen Verlegetechnik D-3F zum Überflechten mit drei Fadensystmen (online verfügbar)
Betreuer: Prof. Berger
2016-02-12 Holl, Kai
Beitrag zum Laserdurchstrahlschweißen von Kunststoffen in der Medizintechnik
Betreuer: Prof. Gehde
2016-01-29 Roder, Kristina
Matrix- und Interfacedesign bei faserverstärkter Keramik auf Basis des Flüssigsilicierverfahrens (online verfügbar)
Betreuer: Prof. Wielage
2016-01-15 Plorin, Daniel
Gestaltung und Evaluation eines Referenzmodells zur Realisierung von Lernfabriken im Objektbereich der Fabrikplanung und des Fabrikbetriebes
Betreuer: Prof. Müller
2015-12-16 Barthel, Tom
Prozessanalyse und effektive Gestaltung von Hochgeschwindigkeitsscherschneidproessen
Betreuer: Prof. Neugebauer
2015-12-16 Zillger, Tino
Ortsaufgelöste Untersuchung massengedruckter Polymersolarzellen auf flexiblem Substrat (online verfügbar)
Betreuer: Prof. Hübler
2015-12-16 Müller, Michael
Direktmontage von Pierzokeramik-Bauelementen in mikrostrukturierte Bleche
Betreuer: Prof. Neugebauer
2015-12-04 Reißmann, Jan
Beitrag zur Entwicklung einer verbesserten Berechnungsmethode für die Ermittlung der Zahnfußtragfähigkeit von Zylinderschneckengetrieben (online verfügbar)
Betreuer: Prof. Leidich
2015-11-27 Pelic, Bernadeta
Nanoscale surface engineering for improved corrosion resistance of TiAl, PbSn and CuZn alloys
Betreuer: Prof. Lampke
2015-11-23 Siegel, Frank
Tiefdruckverfahren zur Herstellung von Katalysatorschichten für (PEM) Brennstoffzellen (online verfügbar)
Betreuer: Prof. Baumann
2015-11-20 Hausner, Susann
Potential von Nanosuspensionen zum Fügen bei niedrigen Temperaturen (online verfügbar)
Betreuer: Prof. Wielage
2015-11-20 König, Johannes
Auslegung eines optimierten Lichtbogendrahtspitzprozesses für Zylinderlaufbahnen von Verbrennungsmotoren
Betreuer: Prof. Wielage
2015-11-20 Lätzer, Michael
Untersuchungen zum Füge- und Übertragungsverhalten torsionsbelasteter Stahl-Aluminium-Rändelpressverbindungen (online verfügbar)
Betreuer: Prof. Leidich
2015-11-06 Schellenberg, Dirk
Identifikation und Optimierung im Kontext technischer Anwendungen
Betreuer: Prof. Ihlemann
2015-11-02 Israel, Markus
Sensitivitäts- und Robustheitsanalyse beim Clinchen dicker Stahlbleche
Betreuer: Prof. Neugebauer
2015-10-30 Walther, Mario
Entwicklung und Evaluierung eines systematischen Vorgehens zur Erfassung von Aktionskräften in der Automobilproduktion (online verfügbar)
Betreuer: Prof. Bullinger-Hoffmann
2015-10-20 Landgraf, Ralf
Modellierung und Simulation der Aushärtung polymerer Werkstoffe (online verfügbar)
Betreuer: Prof. Ihlemann
2015-10-19 Schneebauer, Martin
Neue Kunststofftechnologien zur Herstellung hybrider Leichtbaustrukturen mit hoher Funktionsdichte
Betreuer: Prof. Kroll
2015-10-07 Müller, Christoph
Untersuchung von Holzwerkstoffen unter Schlagbelastung zur Beurteilung der Werkstoffeignung für den Maschinenbau (online verfügbar)
Betreuer: Prof. Nendel
2015-10-05 Elgert, Thomas
Entwicklung eines Vorgehensmodells zur Unterstützung der Implementierung betrieblicher Informationssysteme in der Automobilproduktion – unter besonderer Berücksichtigung der Arbeits- und Prozessorganisation
Betreuer: Prof. Müller
2015-09-30 Oppelt, Thomas
Modell zur Auslegung und Betriebsoptimierung von Nah- und Fernkältenetzen (online verfügbar)
Betreuer: Prof. Platzer
2015-09-29 Hackert-Oschätzchen, Matthias
Gestaltung von elektrochemischen Abtragsprozessen durch Multiphysiksimulation gezeigt an der Endformgebung von Mikrobohrungen
Betreuer: Prof. Schubert
2015-09-28 Moch, Robert
Methodik zur Auswahl und zum Einsatz von Koordinationsinstrumenten in Produktionsnetzen
Betreuer: Prof. Müller
2015-09-04 Huang, Weilin
Beitrag zum Kerbspannungsverhalten anisotrop verstärkter Mehrschichtverbunde unter Berücksichtigung hygrothermischer Einflüsse
Betreuer: Prof. Kroll
2015-08-19 Schulze, Robin
Methodik zur integrativen Funktionsbestimmung und Dimensionierung von Maschinen und Transportmitteln
Betreuer: Prof. Müller
2015-07-28 Fischer, Marko
Leitfaden für Anlaufmanagement im Automobilbau unter Berücksichtigung von Standortbestimmungen
Betreuer: Prof. Müller
2015-07-23 Englich, Sascha
Strukturbildung bei der Verarbeitung von glasfasergefüllten Phenolformaldehydformmassen (online verfügbar)
Betreuer: Prof. Gehde
2015-06-29 Trnovec, Bystrik
Experimentelle Untersuchungen zur Schichtbildung im Tiefdruck mittels hydrophobierter Druckform mit Applikationsbeispielen aus dem Bereich der gedruckten OPV (online verfügbar)
Betreuer: Prof. Hübler
2015-06-24 Asdonk, Matthias
Modell zur Darstellung der Schlüsselelemente und Mechanismen eines Führungssystems Shop Floor
Betreuer: Prof. Müller
2015-06-23 Hopf, Hendrik
Methodik zur Fabriksystemmodellierung im Kontext von Energie- und Ressourceneffizienz
Betreuer: Prof. Müller
2015-04-15 Langer, Tino
Ermittlung der Produktivität verketteter Produktionssysteme unter Nutzung erweiterter Produktdaten
Betreuer: Prof. Neugebauer
2015-04-15 Schützle, Wilhelm
Beitrag zur Prozesskettensimulation geschweißter Aluminium-Karosserieanbauteile
Betreuer: Prof. Neugebauer
2015-04-09 Dittrich, Frank
Instrumentarium zur Unterstützung der nutzerzentrierten Entwicklung in kleinen und mittleren Unternehmen am Beispiel betrieblicher Anwendungssoftware
Betreuer: Prof. Bullinger-Hoffmann
2015-03-27 Ebert, Falk
Serielle Modellierung ebener Band- und Koppelgetriebe zur domänenübergreifenden Gesamtsimulation von nichtlinearen Antriebssystemen (online verfügbar)
Betreuer: Prof. Berger
2015-03-16 Heine, Andreas
Ein Beitrag zur kennwertorientierten Entwicklung von kurvengesteuerter, ebener Schrittgetriebe (online verfügbar)
Betreuer: Prof. Berger
2015-03-03 Petraus, Bernd
Modellbasierte proaktive Kommunikationsanalyse anhand der Projektstruktur und -organisation
Betreuer: Prof. Müller
2015-02-26 Schwanitz, Stefan
Mechanische Simulation der Interaktion Sportler-Sportgerät (online verfügbar)
Betreuer: Prof. Odenwald
2015-02-19 Zinecker, Mike
Einsatz mikro- und mesostrukturierter Oberflächen zur Verbesserung des Wärmeübergangs bei der Siedekühlung
Betreuer: Prof. Schubert
2015-01-27 Jentsch, David
Wandlungsfähigkeit im Management produzierender Unternehmen
Betreuer: Prof. Müller
2015-01-08 Mammitzsch, Jens
Untersuchungen zum Einsatz von ultrahochmolekularen Polyethylenfasern in Seilen für die Fördertechnik (online verfügbar)
Betreuer: Prof. Nendel
2014-12-12 Emmrich, Jens
Ein Beitrag zum technologischen Konzept, zur Funktion und Berechnung hybrider Filterzyklone für die Partikelabscheidung aus Gasen (online verfügbar)
Betreuer: Prof. Wozniak
2014-12-11 Frint, Philipp
Lokalisierungsphänomene nach kombinierter hochgradig plastischer Umformung durch Extrusion und ECAP einer 6000er-Aluminiumlegierung
Betreuer: Prof. Lampke
2014-12-05 Liu, Yao
Heat transfer process between polymer and cavity wall during injection molding (online verfügbar)
Betreuer: Prof. Gehde
2014-12-04 Hoyer, Stefan
Neuartige Warmmahltechnologie zum Recycling von Elastomeren und Analyse prozessbedingter Eigenschaften
Betreuer: Prof. Kroll
2014-11-07 Eben, Johannes
Identifikation und Reduzierung realer Schwankungen durch praxistaugliche Prozessführungsmethoden beim Spritzgießen (online verfügbar)
Betreuer: Prof. Gehde
2014-11-04 Imgrund, Christian
Ganzheitliche Ansätze und Methoden zur nachhaltigen Nauplanung einer energieeffizienten Fabrik mit besonderem Schwerpunkt auf die Automobilmontage (online verfügbar)
Betreuer: Prof. Platzer
2014-11-03 Oehme, Daniel
Bausteinbasiertes Modell zur Integration von Projektplanung, Projektbearbeitung und Projektabschluss für Fabrikplanungsprojekte
Betreuer: Prof. Müller
2014-10-24 Hellmich, Arvid Sören
Nichtinvasive Identifikation von Regelstreckenparametern für elektromechanische Achsen
Betreuer: Prof. Neugebauer
2014-10-24 Glänzel, Janine
Korrektur thermoplastischer Verformungen durch den Einsatz der adaptiven FEM
Betreuer: Prof. Neugebauer
2014-10-23 Höer, Martin
Einfluss der Material- und Verarbeitungseigenschaften von Phenolharzformmassen auf die Qualität spritzgegossener Bauteile (online verfügbar)
Betreuer: Prof. Gehde
2014-10-17 Sommer, Oliver
Ein Beitrag zur Untersuchung des Verhaltens dünner Flüssigkeitsfilme nahe gekrümmten Substratoberflächen - Exp. Beschichtungsversuche und numerische Filmsimulation (online verfügbar)
Betreuer: Prof. Wozniak
2014-10-06 Bankwitz, Hagen
Simulation und Analyse ringgespannter Zahnriemengetriebe (online verfügbar)
Betreuer: Prof. Nendel
2014-09-25 Merklinger, Verena
Beitrag zur Entwicklung einer niedrigschmelzenden Legierung und deren Applikation zum Korrosionsschutz hochfester Stahlsorten
Betreuer: Prof. Wielage
2014-09-24 Weise, Sebastian
Entwicklung und Evaluation von Hochleistungsgleitketten aus Kunststoff
Betreuer: Prof. Nendel
2014-09-19 Grönke, Kerstin
Beitrag zur Optimierung der Verfahrensparameter von Vliesstoffausrüstungsprozessen bei hohen Warengeschwindigkeiten (online verfügbar)
Betreuer: Prof. Platzer
2014-08-22 Zwingenberger, Carsten
Beitrag zur Verbesserung der Simulationsgenauigkeit bei der Bestimmung des thermischen Verhaltens von Werkzeugmaschinen
Betreuer: Prof. Neugebauer
2014-08-04 Wonneberger, Kai-Uwe
Konzept zur Zielplanung für die Fabrikplanung mit unternehmenswertorientierter Ausrichtung
Betreuer: Prof. Müller
2014-07-03 Mäder, Thomas
Neuartige Sensoren zur Erfassung von Dehnungen in Faserverbundwerkstoffen (Structural Health Monitoring) (online verfügbar)
Betreuer: Prof. Wielage
2014-06-26 Friedrich, Sven
Lineares Vibrationsschweißen von Kunststoffen im industriellen Umfeld - Einflüsse und Restriktionen (online verfügbar)
Betreuer: Prof. Gehde
2014-06-23 Münnich, Mario
Strategische multikriterielle Standort- und Fabrikplanungsmethodik mittels szenariendifferenzierter und risikobasierter Produktrechnungen
Betreuer: Prof. Müller
2014-06-19 Kaufmann, Jörg
Beitrag zu anisotropiebedingten Koppeleffekten bei rotationssymmetrischen mehrschichtigen Faserverbundbauteilen
Betreuer: Prof. Kroll
2014-05-23 Feuerhack, Andreas
Experimentelle und numerische Untersuchungen von Al-Mg-Verbunden mittels Verbundschmieden (online verfügbar)
Betreuer: Prof. Awiszus
2014-05-09 Shutov, Alexey
Numerische Simulation des viskoplastischen Verhaltens metallischer Werkstoffe bei endlichen Deformationen14.11.2012 (online verfügbar)
Betreuer: Prof. Ihlemann
2014-04-04 Jentsch, Martin
Eignung von objektiven und subjektiven Daten im Fahrsimulator am Beispiel der aktiven Gefahrenbremsung – eine vergleichende Untersuchung (online verfügbar)
Betreuer: Prof. Spanner-Ulmer
2014-03-17 Hälsig, Andrè
Energetische Bilanzierung von Schutzgasschweißverfahren (online verfügbar)
Betreuer: Prof. Mayr
2014-03-10 Georgi, Wolf
Beitrag zum mechanischen Fügen von Metall-Kunststoff-Mischverbindungen (online verfügbar)
Betreuer: Prof. Matthes
2014-03-04 Kotik, Florian Max
Integration von Fertigungswissen in den digitalen Planungsprozess der Automobilindustrie
Betreuer: Prof. Müller
2014-03-04 Scherf, Christian
Entwicklung, Herstellung und Evaluation des Modularen Alterssimulationsanzugs eXtra(MAX) (online verfügbar)
Betreuer: Prof. Spanner-Ulmer
2014-02-27 Rutsch, Andreas
Methodik zur Gestaltung von Lagersystemen in globalen Distributionsnetzwerken für Multibranchenprodukte dargestellt am Beispiel der DKHS Holding, Schweiz
Betreuer: Prof. Müller
2014-02-10 Chen , Xiaoli
Beitrag zur Bewertung technologischer Innovationsfähigkeit sowie zur Entscheidungsunterstützung für Unternehmen in Innovationsnetzwerken
Betreuer: Prof. Müller
2014-02-05 Ebbinghaus, Michael
Untersuchung der Verarbeitungseigenschaften im MIG-und Laserlötprozess an Stahlblechen mit unterschiedlichem Festigkeitsverhalten (online verfügbar)
Betreuer: Prof. Matthes
2014-01-30 Schönherr, geb. Jendrusch, Ricardo
Simulationsbasierte Absicherung der Ergonomie mit Hilfe digital beschriebener menschlicher Bewegungen (online verfügbar)
Betreuer: Prof. Spanner- Ulmer
2014-01-29 Kleditzsch, Stefan
Beitrag zur Modellierung und Simulation von Zylinderdrückwalzprozessen mit elementaren Methoden (online verfügbar)
Betreuer: Prof. Awiszus
2014-01-24 Gansauge, Ludwig-Ingo
Methodik zur Industrialisierung der Einzelfertigung am Beispiel des Werkzeug- und Formenbaus
Betreuer: Prof. Müller
2014-01-14 Pinner, Sebastian
Untersuchung von Methoden zur durchgängigen Prozesskettensimulation im Karosseriebau
Betreuer: Prof. Awiszus
2013-12-18 Kick, Marco
Gebremste Laufwagensysteme für Schwerkrafthängeförderer im Rahmen einer nachhaltigen Low-Cost-Fördertechnik
Betreuer: Prof. Nendel
2013-12-09 Jakubik, Uwe
Effizienzermittlung von Maßnahmen mit Gwichtsauswirkung in der PkW-Entwicklung (online verfügbar)
Betreuer: Prof. Leidich
2013-12-02 Drechsler, Florian
Modulares Behältersystem für die Automobilindustrie, deren Zulieferer und Logistikdienstleister
Betreuer: Prof. Nendel
2013-11-13 Özer, Ihsan Ulas
Legierungstechnische und tribologische Entwicklung von Bremsscheiben aus Aluminium-Matrixkompositen
Betreuer: Prof. Lampke
2013-11-08 Truckenbrodt, Christian
Beitrag zur Entwicklung und Integration unterschiedlicher Methoden zur Online-Qualitätssicherung beim Laserstrahlschweißen von Aluminiumkehlnähten
Betreuer: Prof. Neugebauer
2013-11-06 Maurer, Thomas
Zur kosteneffizienten Herstellung von gewickelten Faserverbundwalzen unter Berücksichtigung der Methode der Lean Production (online verfügbar)
Betreuer: Prof. Kroll
2013-11-04 Nestler, Daisy
Beitrag zum Thema: Verbundwerkstoffe - Werkstoffverbunde - Status quo und Forschungsansätze (online verfügbar)
Betreuer: Prof. Wielage
2013-10-16 Teich, Tobias
Geschäftsprozessgetriebene Konfiguration wandlungsfähiger Gebäudeinfrastrukturen
Betreuer: Prof. Müller
2013-09-23 Lauterbach, Johannes Michael
Energie ScoreCard - Bewertungskriterien für Kraftwerke und ihre Relevanz aus Investorensicht
Betreuer: Prof. Platzer
2013-09-04 Zhang , Ran
Spanen thermoplastischer Kunststoffe mit vielschneidigen geometrischen nicht bestimmten Schneiden (Schleifen und Polieren)
Betreuer: Prof. Schubert
2013-08-16 Heinze, Thorsten
Zug- und biegewechselbeanspruchte Seilgeflechte aus hochfesten Polymerfasern
Betreuer: Prof. Nendel
2013-08-14 Krebs, Janine
Zum Einfluss der Werkzeugoberfläche auf die Entformbarkeit und die Oberflächenqualität von Spritzgießbauteilen
Betreuer: Prof. Kroll
2013-07-30 Gröger, Sophie
Funktionsgerechte Spezifikation geometrischer Eigenschaften mit dem System der Geometrischen Produktspezifikation und -verifikation (online verfügbar)
Betreuer: Prof. Dietzsch
2013-07-22 Vay, Henrik
Vorgehensmodell zum Projekt-Risikomanagement im Anlagenbau
Betreuer: Prof. Müller
2013-07-11 Maiwald, Andreas
Numerische Analyse des Wanderverhaltens von Wälzlagerringen
Betreuer: Prof. Leidich
2013-06-21 Bergmann, Markus
Verfahren zur Herstellung gradiert hochgradig plastisch umgeformter Werkstoffe
Betreuer: Prof. Neugebauer
2013-06-21 Dix, Martin
Ressourceneffizientes Hochleistungsbohren mit Spiralbohrern - Analyse und Prozessauslegung
Betreuer: Prof. Neugebauer
2013-06-19 Hübler, Jörg
Textilverstärkte Zugmittel für die Antriebs- und Fördertechnik mit formschlüssiger Krafteinleitung (online verfügbar)
Betreuer: Prof. Nendel
2013-06-04 Brückner, Karoline
Charakterisierung der mechanischen Eigenschaften von weichelastischen Schaumstoffen unter impulsartigen sportspezifischen Belastungen (online verfügbar)
Betreuer: Prof. Odenwald
2013-05-29 Weigelt, Karin
Integration gedruckter Elektronik in Kunststoffe durch Folienhinterspritzen (online verfügbar)
Betreuer: Prof. Hübler
2013-05-08 Clauß, Michael
Methode zum Einsatz von Web 2.0-Werkzeugen in der Fabrikplanung (online verfügbar)
Betreuer: Prof. Müller
2013-05-03 Klimant, Philipp
Virtual Reality gestützte Kinematik- und Materialabtragssimulation für Fräsmaschinen mittels Hardware-in-the-Loop
Betreuer: Prof. Neugebauer
2013-05-03 Kräusel , Verena
Gestaltung und Bewertung einhubiger Scherschneidverfahren mit starren Werkzeugen unter besonderer Berücksichtigung der Schnittflächenqualität an Blechbauteilen
Betreuer: Prof. Neugebauer
2013-05-02 Bester, Alwyn
Entwicklung von alternativen Erwärmungsmethoden für Mangan-Bor-Stähle
Betreuer: Prof. Neugebauer
2013-04-11 Schönherr, Micaela
Entwicklung und Implementierung produktbezogener Dienstleistungen in der Werkzeugmaschinenindustrie
Betreuer: Prof. Neugebauer
2013-03-26 Dombeck, Uwe
Beitrag zur Dimensionierung von Fördersystemen mit Staurollenketten (online verfügbar)
Betreuer: Prof. Nendel
2013-03-15 Winkler, Sebastian
Generierung von Teilarbeitsgängen im Rahmen eines durchgängigen Ansatzes zur automatischen Arbeitsplanerstellung
Betreuer: Prof. Müller
2013-03-12 Schade, Klaus Peter
Experimentelle Untersuchungen des Einflusses der Wandrauigkeit auf Rückprallgeschwindigkeit und Partikelrotation kleiner Partikel beim Aufprall auf feste Wände
Betreuer: Prof. Wozniak
2013-03-04 Philipp, Klaus
Kosteneffiziente Leichtbaustrukturen für denPkw-Innenraum mit hochwertigen funktionellen Oberflächen
Betreuer: Prof. Kroll
2013-02-28 Härtig, Thomas
Stoffübertragung beim Spritzgießen (online verfügbar)
Betreuer: Prof. Gehde
2013-02-20 Helbig, geb. Speck, Markus
Methoden zur Bestimmung der Ablegereife an hochfesten Kunstfaserseilen
Betreuer: Prof. Nendel
2013-02-20 Seidlitz, Holger
Entwicklung von kraftflussgerechten Verbindungstechniken für Mischbauweisen mit thermoplastischen Faserverbunden und Metallen
Betreuer: Prof. Kroll
2013-02-20 Löser, Carsten
Präzises Schneiden schwer zu bearbeitender Materialien durch Wasserabrasivinjektorstrahlen mit verringertem Strahldurchmesser
Betreuer: Prof. Dürr
2013-02-15 Freund, Michael
Verallgemeinerung eindimensionaler Materialmodelle für die Finite-Elemente-Methode
Betreuer: Prof. Ihlemann
2013-02-07 Härtel, Sebastian
Experimentelle und numerische Untersuchungen zur Verfahrensentwicklung des Unrunddrückens (online verfügbar)
Betreuer: Prof. Awiszus
2013-01-28 Li , Lei
Synergetische Planungsmethodik für Industrieparks
Betreuer: Prof. Müller
2013-01-25 Fuhrich, René
Infrarotschweißen von Kunststoffen mit thermischen Strahlungsemittern
Betreuer: Prof. Gehde
2013-01-24 Heuß, Hans-Peter
Qualifikation als Innovationsfaktor am Beispiel der externen Promotion
Betreuer: Prof. Spanner-Ulmer
2013-01-15 Ponton, Philipp Manuel
Methodik zur Abwicklung von Produktionsverlagerungen
Betreuer: Prof. Müller
2013-01-09 Rohrmus, Dominik
Adaptive invariante Merkmale für die Texturklassifikation
Betreuer: Prof. Awiszus
2013-01-08 Waltl, Hubert
Selbstoptimierung der Einarbeit von Karosseriewerkzeugen durch werkzeugintegrierte Aktorik
Betreuer: Prof. Neugebauer
2012-12-20 Buschmann, Markus
Planung und Betrieb von Energiedatenerfassungssystemen
Betreuer: Prof. Müller
2012-12-19 Eichhorn, Sven
Berechnungsansatz für Strukturbauteile aus Holzfurnierlagenverbundwerkstoff-WVC (online verfügbar)
Betreuer: Prof. Nendel
2012-12-19 Eckardt, Ronny
Untersuchungen an Verbindungselementen für Holzkonstruktionen im Maschinen- und Anlagenbau (online verfügbar)
Betreuer: Prof. Nendel
2012-12-14 Nestler, Andreas
Erzeugung definierter Oberflächeneigenschaften bei der Drehbearbeitung von partikelverstärkten Aluminiummatrix-Verbundwerkstoffen
Betreuer: Prof. Schubert
2012-12-13 Jung, geb.Steger, Heike
Neuartige dispersionsverstärkte Kontaktwerkstoffe auf Silber-Basis
Betreuer: Prof. Wielage
2012-12-12 Göppert , Stefan
Fluidstrahlen - Erzeugung, Strömungsfeld und Wärmeübergang
Betreuer: Prof. Platzer
2012-12-03 Kausch, Martin
Entwicklung hochbelasteter Leichtbaustrukturen aus lasergenerierten metallischen Komponenten mit Faserverbundverstärkung
Betreuer: Prof. Kroll
2012-11-29 Leesch, Mirko
Beitrag zur systematischen Synthese und Bewertung von Doppelkupplungsgetrieben
Betreuer: Prof. Tenberge
2012-11-29 Rupprecht , Christian
Moderne Methoden und Anwendungen des Thermischen Spritzens (online verfügbar)
Betreuer: Prof. Wielage
2012-11-29 Nickel , Daniela
Ausgewählte Eigenschaften und Charakterisierungsmethoden von biodegradierbaren und archäologischen metallbasierten Werkstoffen
Betreuer: Prof. Lampke
2012-11-16 Krauß, Andreas
Zustandsgeregelte dynamische Dimensionierung von Produktionssystemen im Kontext des Produktionsmanagements (online verfügbar)
Betreuer: Prof. Müller
2012-11-02 Riedel, Ralph
Systemische Fabrikplanung auf Basis eines kybernetisch-soziotechnischen Modells
Betreuer: Prof. Müller
2012-11-01 Scholz, Sebastian
Epoxidharzbasierte Nanokomposit-Schichten für mechanisch, tribologisch und medial belastete Faser-Kunststoff-Verbunde
Betreuer: Prof. Kroll
2012-10-26 Hermann, Jörn
Kennzahlbasierte Planungsmethode zur Optimierung der Anlagennutzung von Großteilpressen
Betreuer: Prof. Neugebauer
2012-10-19 Herrle, Tobias
Entwicklung und Erprobung eines Online-Lackmischverfahrens für die Automobilserienlackierung
Betreuer: Prof. Wozniak
2012-10-05 Richter, Markus
Virtual Reality-unterstützte Optimierung des dynamischen Verhaltens von Werkzeugmaschinen
Betreuer: Prof. Neugebauer
2012-10-04 Kuprin, geb. Gahlert, Corinna
Verformungsverfestigung bei zyklisch inkrementeller Torsion von Reineisen und dem Stahl 42CrMo4N (online verfügbar)
Betreuer: Prof. Wagner
2012-09-26 Mainda, Patrick Michael
Piezoelektrische Aktoren in Presswerkzeugen zur Beeinflussung des Umformprozesses
Betreuer: Prof. Neugebauer
2012-09-25 Hofmann, Stefan
Identifikation parametrischer Modelle für geregelte, elektromechanische Achsen mit modifizierter sukzessiver Polkompensationan mechatronischen Achsen
Betreuer: Prof. Neugebauer
2012-09-05 Tröltzsch, Jürgen
Spritzgießtechnische Direktimprägnierung textiler Halbzeuge und Preformen bei komplexen Hochleistungsbauteilen
Betreuer: Prof. Kroll
2012-08-24 Ihlenfeldt, Steffen
Redundante Werkzeugmaschinenstruktur für die Komplettbearbeitung im Großwerkzeugbau - Modellbasierter Systementwurf und Prototyp
Betreuer: Prof. Neugebauer
2012-07-30 Neukirchner, Heiko
Wirkungsgrade und dynamisches Verhalten von Ventilsteuerungen mit pneumatischer Ventilfeder
Betreuer: Prof. Tenberge
2012-07-30 Endres, Martin
Entwicklung einer aktiven Steuerung für die geometrischen Qualitätsziele der Prozesskette Karosseriebau
Betreuer: Prof. Dietzsch
2012-07-18 Rasch, Frank
Reibungsminderung an Stütz- und Führungselementen für Kunststoffketten
Betreuer: Prof. Nendel
2012-07-12 Darwich , Samer
Corrosion protection concepts for aluminium and magnesium alloys coated with silicate films prepared by water-based-sol-gel process (online verfügbar)
Betreuer: Prof. Lampke
2012-07-12 Edelmann, Jan
Mikrostrukturierung von Flachglas durch Heißprägen
Betreuer: Prof.Schubert
2012-06-29 Petersen, Udo
Beitrag zum Übertragungsverhalten von rechteckförmigen Mehrschraubenverbindungen (MV)
Betreuer: Prof. Leidich
2012-06-29 Lehmann, Thomas
Experimentell-numerische Analyse mechanischer Eigenschaften von Aluminium/Magnesium-Werkstoffverbunden
Betreuer: Prof. Ihlemann/Dr. Stockmann
2012-06-28 Jander, Henning
Entwicklung einer Methode zur produktbasierten Reduzierung der Zeitspreizung in der Automobilmontage
Betreuer: Prof. Spanner- Ulmer
2012-06-22 Kolouch, Martin
Simulation des Einflusses der Gelenke auf das statische und dynamische Verhalten von parallelkinematischen Werkzeugmaschinen
Betreuer: Prof. Neugebauer
2012-06-21 Schönherr, Ruben
Regelkreisüberwachung mechatronischer Antriebssysteme
Betreuer: Prof. Neugebauer
2012-06-20 Wetzel, Tommy
Magnesiumblech-Technologiekette für innovative Leichtbauanwendungen im Automobilbau
Betreuer: Prof. Neugebauer
2012-06-12 Kranz, Burkhard
Beitrag zur numerischen Beschreibung des funktionellen Verhaltens von Piezoverbundmodulen (online verfügbar)
Betreuer: Prof. Neugebauer
2012-05-31 Eckert, Alexander
Prognose der Maßhaltigkeit punktförmig mechanisch gefügter Karosseriebauteile
Betreuer: Prof. Neugebauer
2012-05-22 Reuter, Kay
Elektrostatische Aufladung von organischen Feldeffekttransistoren zur Verbesserung einfacher gedruckter Schaltungen (online verfügbar)
Betreuer: Prof. Hübler
2012-05-16 Dreves, Frank
Empirische Studie von Werkmechanismen zum Wandel in der Arbeitswelt am Beispiel Ergonomie, Demographie und Führung
Betreuer: Prof. Spanner-Ulmer
2012-05-11 Kittner, Kai
Integrativer Modellansatz bei der Co-Extrusion von Aluminium-Magnesium-Verbunden (online verfügbar)
Betreuer: Prof. Awiszus
2012-04-20 Deckert, Matthias H.
Beitrag zur Entwicklung eines hochdynamischen variothermen Temperiersystems für Spritzgießwerkzeuge (online verfügbar)
Betreuer: Prof. Kroll
2012-03-27 Badra, Hashem
Entwicklung eines Navigators für die Fertigungssimulation
Betreuer: Prof. Müller
2012-03-20 Weis, Sebastian
Beitrag zur Entwicklung partikelverstärkter Weich- und Weichaktivlote zum Fügen temperaturempfindlicher Aluminiummatrix-Verbundwerkstoffe (online verfügbar)
Betreuer: Prof. Wielage
2012-03-16 Stocek, Radek
Zur dynamischen Rissausbreitung von Elastomerwerkstoffen (online verfügbar)
Betreuer: Prof. Gehde
2012-03-07 Mühlstedt, Jens
Entwicklung eines Modells dynamisch-muskulärer Arbeitsbeanspruchungen auf Basis digitaler Menschmodelle (online verfügbar)
Betreuer: Prof. Spanner-Ulmer
2012-02-22 Ommer, Matthias
Korrelation zwischen Herstellverfahren, Gefüge und Eigenschaften lichtbogenbelasteter Silber-Metalloxid-Kontaktwerkstoffe (online verfügbar)
Betreuer: Prof. Wielage
2012-02-09 Zeidler, Henning
Schwingungsunterstützte Mikro-Funkenerosion
Betreuer: Prof. Schubert
2012-02-08 Billig, Susan
Abbau von Polyethylenterephthalat mit PET-Hydrolasen aus Thermobifida fusca KW3 (online verfügbar)
Betreuer: Prof. Platzer; Prof. Zimmermann
2012-02-08 Müller, Jörg
Beitrag zur systematischen, rechnergestützten Synthese und Bewertung mehrgängiger konventioneller und hybrider Planetenautomatikgetriebe
Betreuer: Prof. Tenberge
2012-01-31 Tran , Ngoc Anh
Featurebasierte Entscheidungsmethodik zur Bewertung alternativer technologischer Prozessketten in der Teilefertigung
Betreuer: Prof. Dürr
2012-01-23 Beyer, Ulrike
Multi-Flach-Fügen mittels Flach-Clinch-Technologie
Betreuer: Prof. Awiszus
2011-12-22 Rinberg, Roman
Technologieentwicklung zur Herstellung von naturfaserverstärkten Bauteilen in Leichtbauweise unter Einsatz von Ganzpflanzenrohstoffen
Betreuer: Prof. Kroll
2011-12-16 Jahn, Stephan Felix
Möglichkeiten und Herausforderungen des Funktionsdrucks mittels Inkjettechnologie, gezeigt an zwer Anwendungsbeispielen
Betreuer: Prof. Baumann
2011-12-15 Kienzle, Florian
Fertigungssteuerung in der Musterfertigung von Systemlieferanten (online verfügbar)
Betreuer: Prof. Müller
2011-12-14 Schob, Uwe
Methode zur frühen virtuellen Inbetriebnahme von Steuerungsprogrammen durch halbautomatische Maschinenmodellbildung
Betreuer: Prof. Neugebauer
2011-11-22 Glühmann, Jan
Verschleißmechanismen und Leistungspotenziale stickstoffgesinterter Gradientenhartmetalle für die Zerspanung
Betreuer: Prof. Dürr
2011-11-21 Hubrig, Marko
Methode zur integrativen kostenorientierten Produktionssystemplanung im Kontext der digitalen Fabrik
Betreuer: Prof. Müller
2011-11-15 Urbaneck, Thorsten
Kältespeicher - Grundlagen, Technik, Anwendung
Betreuer: Prof. Platzer
2011-10-17 Schmidt, Georg
Oberflächenspannungstrukturiertes Drucken zur Herstellung polymerelektronischer Bauteile
Betreuer: Prof. Hübler
2011-09-30 Sittiho, Mutchima
Qualitative Beurteilung des Gaseintrages in thermische Energieversorgungssysteme auf Grund der Gaspermeation (online verfügbar)
Betreuer: Prof. Platzer
2011-09-21 Bartzsch, Matthias
Herstellung von Schottky-Dioden mittels Rolle-zu-Rolle-Verfahren
Betreuer: Prof. Hübler
2011-08-30 Hensel-Unger, Ralph
Entwicklung einer Gestaltungssystematik für das Industrial Engineering unter besonderer Berücksichtigung kultureller Einflussfaktoren am Beispiel von Tschechien und Polen
Betreuer: Spanner-Ulmer
2011-08-26 Keil, Mathias
Entwicklung eines arbeitswissenschaftlichen Modellansatzes für die nachhaltige Implementierung von Produktionssystemen in Unternehmen
Betreuer: Spanner-Ulmer
2011-07-29 Chodora, Marco
SALUCONTROL - Nutzen-Aufwand-Kalkulation von Maßnahmen im betrieblichen Gesundheitsmanagement mit Support des Controllings
Betreuer: Prof. Spanner-Ulmer
2011-07-29 Enderlein, Heiko
Flexible Analyse- und Bewertungs-Systematik zur Gestaltung nachhaltig effektiver, effizienter und menschgerechter Arbeit in indirekten Bereichen am Beispiel eines Automobilherstellers
Betreuer: Prof. Spanner-Ulmer
2011-07-26 Hockauf, Kristin
Ermüdungs- und Rissfortschrittsverhalten ausscheidungshärtbarer ultrafeinkörniger Aluminimlegierungen (online verfügbar)
Betreuer: Prof. Lampke
2011-07-22 Kern, Colin
Untersuchung des Betriebsverhaltens von Mehrflächengleitlagern mit Kunststofflaufschicht
Betreuer: Prof. Leidich
2011-05-20 Meißner, Christian
Entwicklung von Getriebesystemen zur aktiven Drehmomentenverteilung für Fahrzeuganwendungen
Betreuer: Prof. Tenberge
2011-04-08 Steinbach, Hendrik
Verfahren zur thermischen und mechanischen Auslegung von zyklisch arbeitenden Radialstromapparaten
Betreuer: Prof. Platzer
2011-03-14 Michael, Markus
Beitrag zur Treibfähigkeit von hochfesten synthetischen Faserseilen (online verfügbar)
Betreuer: Prof. Nendel
2011-03-14 Angermann, Kay
Beitrag zur Entwicklung und Fertigung einer lokalen und beanspruchungsrechten Verstärkung für hochfeste Aluminiumbauteile
Betreuer: Prof. Wielage
2011-03-03 Schneider, Thomas
Automatisierte Akquisition von erfahrungsbasiertem Fertigungswissen im Werkzeug- und Formenbau
Betreuer: Prof. Dürr
2011-02-24 Risch, Thomas
Zweidimensionale Bewegungsformen in der Vibrationstechnik
Betreuer: Prof. Nendel
2011-02-17 Ebert, Lars
Beeinflussung von geschweißten Auftragschichten durch instationäre Gasströme im Plasma-Pulver-Schweißprozess (online verfügbar)
Betreuer: Prof. Matthes
2011-01-28 Hädrich, Katrin
Ermittlungen und Untersuchungen zum Stirnfräsen typischer duro- und thermoplastischer Kunststoffe
Betreuer: Prof. Dürr
2010-12-17 Mejia Ambriz, Alejandro
Produktinnovation durch Kompetenzclusterbildung in kompetenzzellenbasierten Netzen (online verfügbar)
Betreuer: Prof. Neugebauer
2010-12-16 Mayer, Michael
Modellierung des statischen und dynamischen Materialverhaltens langfaserverstärkter Kunststoffe
Betreuer: Prof. Meyer
2010-12-14 Kuhl, Michael
Beitrag zur Qualitätsbewertung von Laserschweißnähten im Karosseriebau durch multivariate Datenanalyse von Sensorsignalen aus Pre-, In- und Postprozessmessverfahren
Betreuer: Prof. Neugebauer
2010-11-26 Kim , Young Eun
Modified Phenol-Formaldehyde Resins for C-Fiber Reinforces Composites: Chemical Characteristics of Resind, Microstructure and Mechanical Properties of their Composites (online verfügbar)
Betreuer: Prof. Wielage
2010-11-12 Lomachenko, Olga
Beiträge zum Einsatz solar unterstützter Systeme zur Beheizung von Industriegebäuden im Bestand
Betreuer: Prof. Platzer
2010-11-02 Faust, Karsten
Neue polymere Werkstoffkonzepte für Fördergleitketten und Systemanalyse der Korrelation von Reibungskoeffizienten
Betreuer: Prof. Nendel
2010-11-01 Leiber, Paul
Ergonomische Produktgestaltung am Beispiel mobiler Geräte im interkulturellen Vergleich: China-Deutschland-USA (online verfügbar)
Betreuer: Prof. Spanner-Ulmer
2010-10-26 King Kordi, Amal
Methodik zur bausteinbasierten Planung und Organisation von verfahrenstechnischen Produktionssystemen
Betreuer: Prof. Müller
2010-10-21 Merz, Ludger
New dynamic approach of a Safety Barrier Wall for a Civil Transport Aircraft
Betreuer: Prof. Kreißig
2010-10-13 Weigert, Philipp
Berücksichtigung formänderungsbedingter Effekte (Rückfederung) im Entwicklungsprozess der Methodenplanung von tiefgezogenen Karosseriebauteilen
Betreuer: Prof. Neugebauer
2010-10-05 Neumann, Norbert
Nutzenbasierte Bewertung und Optimierung von externen Wertschöpfungsstrukturen in der Automobilzulieferindustrie
Betreuer: Prof. Müller
2010-09-16 Wagner, Ulf
Standardisierung der Projektabwicklung im kundenspezifischen Maschinen- und Anlagenbau
Betreuer: Prof. Müller
2010-09-10 Hegner, Claus
Modellbasierte Vernetzung strategischer und operativer Anlaufgrößen von interdependenten Fahrzeugprojekten
Betreuer: Prof. Müller
2010-09-08 Nachtwey, Alexander
Methodischer Beitrag zur Betriebsanalyse komplexer Produktionssysteme
Betreuer: Prof. Müller
2010-06-17 Sritragool , Kunlapaporn
Modification of rubber particle filled thermoplastics with electrons during polymer processing or after molding
Betreuer: Prof. Gehde
2010-06-15 Laue, Martin
Methodik zur humanorientierten Systementwicklung und Kommunikationsoptimierung
Betreuer: Prof. Müller
2010-06-04 Baumgart, Rico
Reduzierung des Kraftstoffverbrauches durch Optimierung von Pkw-Klimaanlagen
Betreuer: Prof. Tenberge
2010-06-03 Simon, Marc
Entwicklung eines ganzheitlichen globalen Projektmanagement Systems unter besonderer Berücksichtigung interkultureller Unterschiede
Betreuer: Prof. Müller
2010-04-20 Lindner, Mario
Ermittlung der plastischen Anfangsanisotropie durch Eindringversuche (online verfügbar)
Betreuer: Prof. Kreißig
2010-03-31 Grund, Thomas
Applikation, Charakterisierung und Einsatz kaltgasgespritzter Kupfer-Nickel-Lotschichten für TiAl 6 V 4-Substrate
Betreuer: Prof. Wielage
2010-03-26 Pursche, Frank
Spezifizierung des Versagensverhaltens von Werkstoffen bei Druck-Scher-Belastung
Betreuer: Prof. Meyer
2010-03-10 Lohse, Rolf
Einfluss von Beladeeinrichtungen auf die thermische Schichtung in Warmwasserspeichern
Betreuer: Prof. Platzer
2009-12-15 Wözel, Margit
Grundlegende Untersuchungen zum Verhalten von Verschleißschutzschichten bei Beanspruchung auf Ermüdungsverschleiß
Betreuer: Prof. Wielage
2009-12-14 Hartmann, Uwe
Erhöhung der Verschleißfestigkeit von aktiven Werkzeugelementen und von Gleitringdichtsystemen im elastomerverarbeitenden Maschinenbau durch Einsatz alternativer Werkstoffe und Technologien
Betreuer: Prof. Wielage
2009-12-14 Halle , Thorsten
Ermittlung und Modellierung von Werkstoffkenndaten metallischer Werkstoffe bei hohen Dehnungsgeschwindigkeiten auf dem Fachgebiet: Werkstofftechnik/Werkstoffprüfung
Betreuer: Prof. Meyer
2009-11-25 Hackert, Matthias
Entwicklung und Simulation eines Verfahrens zum elektrochemischen Abtragen von Mikrogeometrien mit geschlossenem elektrolytischen Freistrahl
Betreuer: Prof. Schubert
2009-11-19 Ecorchard, Gael
Static Accuracy Enhancement of Redundantly Actuated Parallel Kinematic Machine Tools (online verfügbar)
Betreuer: Prof. Neugebauer
2009-10-15 Winkler, Anders
Experimentelle und theoretische Untersuchungen zur kunststoffgerechten Auslegung von Zahnrädern
Betreuer: Prof. Leidich
2009-08-06 Fiebig, Siegfried
Wandel zur flexiblen Fabrik - Konsequenzen für die Steuer- und Fördertechnik
Betreuer: Prof. Nendel
2009-07-16 Reuter, Susann
Untersuchung von Entwicklungs- und Transferprozessen beim flüssigtonerbasierten ferroelektrischen Druckverfahren (online verfügbar)
Betreuer: Prof. Hübler
2009-07-10 Hockauf, Matthias
Fließspannungsverhalten ultrafeinkörniger Aluminiumwerkstoffe unter besonderer Berücksichtigung der Dehnrate
Betreuer: Prof. Meyer
2009-07-07 Khaddour , Mounib
Negativbaufbau im Rollenoffsetdruck (online verfügbar)
Betreuer: Prof. Beier
2009-06-10 Böttcher, Sebastian
Beitrag zur Planung stückzahlflexibler Fertigungssysteme
Betreuer: Prof. Müller
2009-05-26 Nickel, Daniela
Gefüge- und Eigenschaftscharakterisierungen unbeschichteter grobkörniger und ultrafeinkörniger sowie anodisch oxidierter Aluminiumlegierungen
Betreuer: Prof. Wielage
2009-05-15 Nebel, Silvio
Ein Beitrag zur experimentellen und numerischen Analyse zeitabhängiger Eigenschaften von DMS-Messstellen
Betreuer: Prof. Naumann
2009-05-08 Mischke, Michael
Multimodale Bedienkonzepte im Dualtask - ein Ansatz für komplexe Bedienaufgaben im Fahrzeug
Betreuer: Prof. Spanner-Ulmer
2009-04-29 Ebert, Andreas
Berücksichtigung der elastischen Werkzeugdeformation im Bereich der Massivumformung am Beispiel Gesenkschmieden
Betreuer: Prof. Awiszus
2009-04-17 Wießner, Sven
Kontinuierliche Herstellung von Legierungen aus Elastomerpartikeln und Polypropylen durch reaktive Aufbereitung in einem Gleichdralldoppelschneckenextruder (online verfügbar)
Betreuer: Prof. Mennig
2009-04-14 Lehmann, Maik
Entwicklung einer Methodik zur Gestaltung von handlungsleitenden Informationsprozessen in Fertigungsabläufen der variantenreichen Großserienfertigung
Betreuer: Prof. Müller
2009-03-27 Opitz, Andreas
Methodik zur Planung ganzheitlich prozesseffizienter Fertigungssysteme
Betreuer: Prof. Müller
2009-03-06 Hänel, Thomas
Technologieentwicklung für die Herstellung patientenindividueller Knochenaufbauimplantate aus Beta-Tricalciumphosphat durch 3D-Printing
Betreuer: Prof. Dürr
2009-03-05 Bahn, Volker
Implementierung der Mehrpunkt-Technologie in den Innenhochdruck-Blechumformprozess (IHB)
Betreuer: Prof. Neugebauer
2009-03-02 Rupprecht, Christian
Ganzheitliche Verfahrens- und Schichtoptimierung für das Hochgeschwindigkeitsdrahtflammspritzen (online verfügbar)
Betreuer: Prof. Wielage
2009-02-17 Dietrich, Axel Maximilian
Gestaltung intra-organisationaler Produktionsnetzwerke - Methodik zur Konfiguration und Bewertung unternehmensinterner Produktionsnetzwerke mit standortübergreifender Kooperation zwischen Entwicklung und Produktion
Betreuer: Prof. Müller
2009-02-11 Schlegel, Gert
Experimentelle Untersuchungen zu Farbfilmbildungsprozessen in Sprühfarbwerken von Offsetdruckmaschinen (online verfügbar)
Betreuer: Prof. Hübler
2009-02-05 Bolick, Susanne
Integration von Prozessketten und Workflowmodellierung in PDM-Systemen
Betreuer: Prof. Awiszus
2009-02-03 Höinghaus, Lars
Entwicklung einer Simulationsmethodik zur Optimierung des Kühlschmierstoffeinsatzes bei mehrstufigen Warmumformprozessen
Betreuer: Prof. Awiszus
2009-01-26 Mokhtar , Mohd Noriznan
Biocatalytic Production, Preparation and Characterization of Large-Ring Cyclodextrins (online verfügbar)
Betreuer: Prof. Platzer/ Prof. Zimmermann
2009-01-16 Leischnig, Steffen
Entwicklung standardisierter Abläufe zur Verbesserung der Prozesszuverlässigkeit von Fertigungsanlagen (online verfügbar)
Betreuer: Prof. Müller
2009-01-09 Fischer, Thomas
Erzeugung leitfähiger Strukturen auf benetzungsstrukturierten Polymeroberflächen
Betreuer: Prof. Hübler
2008-12-15 Heintz, Steffen
Kooperationskultur projektbezogener Unternehmenskooperationen in KMU - Ein Beitrag zur Entwicklung eines Gestaltungsansatzes
Betreuer: Prof. Müller
2008-12-05 Baum, Heiko
Morphologie der Kooperation als Grundlage für das Konzept der Zwei-Ebenen-Kooperation
Betreuer: Prof. Müller
2008-12-04 Engelmann, Jörg
Methoden und Werkzeuge zur Planung und Gestaltung energieeffizienter Fabriken
Betreuer: Prof. Müller
2008-11-28 Schwörer, Falko
Methodik zur Vernetzung geographisch verteilter Forschungs- und Entwicklungstendenzen
Betreuer: Prof. Müller
2008-11-06 Werner, André
Thermische Stabilität von abriebfähigen Ddichtungswerkstoffen auf Nickel- oder Kobaltbasis für Hochdruckverdichter
Betreuer: Prof. Wielage
2008-10-23 Schulz, Bertram
Hochgenaue Lagezuordnung von Mikrobauteilen durch greiferintegrierte Winkelfeinstellungen (online verfügbar)
Betreuer: Prof. Neugebauer
2008-10-17 Gleich, Sven
Simulation des thermischen Verhaltens spanender Werkzeugmaschinen in der Entwurfsphase
Betreuer: Prof. Neugebauer
2008-09-18 Lehmann, Jens
Entwicklung von Methoden für Fabrikplanungsprozesse unter Nutzung von Werkzeugen der Digitalen Fabrik
Betreuer: Prof. Müller
2008-09-17 Kaiser, Michael
Mehrkriterielle Adaption multimedialer Prozessbeschreibungen für den Fabrikbetrieb mittels wissensbasierter Planungssysteme
Betreuer: Prof. Müller
2008-09-12 Thurner, Stefan
Erzeugung und Anwendung modulierter Prozessgasströme beim Schutzgasschweißen (online verfügbar)
Betreuer: Prof. Matthes
2008-08-29 Herzig, Norman
Beitrag zur Erfassung und Beschreibung des skalierten Fließ.-Verfestigungs- und Versagensverhalten ausgewählter metallischer Werkstoffe in einem weiten Bereich von Dehngeschwindigkeiten und Temperaturen (online verfügbar)
Betreuer: Prof. Meyer
2008-08-27 Binotsch, Carolin
Modellierung und Simulation des KRM- Planetenschrägwalzprozesses
Betreuer: Prof. Awiszus
2008-08-14 Mitzschke, Frank
Eigenschaftsprofile neuartiger faserverstärkter Kunststoffgleitketten für den Stückguttransport
Betreuer: Prof. Nendel
2008-08-11 Linke, Thomas
Ein Beitrag zur Dimensionierung des Schüttgutaustrages mittels Umschlagrad
Betreuer: Prof. Nendel
2008-07-24 Henze, Lars
Entwicklung einer Methode zum Aufdecken von potentiellen Fehlern in der Konstruktion (online verfügbar)
Betreuer: Prof. Dietzsch
2008-07-17 Gerlach, Marco
Erfassungsstrategie zur Ermittlung des Paarungsmaßes an zylindrischen Oberflächen für die mechanische Antastung (online verfügbar)
Betreuer: Prof. Dietzsch
2008-07-11 Walther, Volkhard
Grundlagen des Übertragungsverhaltens zentralverschraubter Stirnpressverbindungen
Betreuer: Prof. Leidich
2008-06-18 Hanke, Markus
Methodik zur Bewertung des thermo-mechanischen Verhaltens von komplexen kubischen Aluminiumwerkstücken bei der Trockenbearbeitung
Betreuer: Prof. Dürr
2008-06-06 Seifert, Michael
Temperiertes Innenhochdruck-Umformen von Rohren aus Magnesium- und Aluminiumlegierungen (online verfügbar)
Betreuer: Prof. Neugebauer
2008-06-05 Kaden, Hendrik
Beitrag zum Reibungs- und Verschleißverhalten von Zahnriemenförderern (online verfügbar)
Betreuer: Prof. Nendel
2008-06-03 Cho , Sang Hyun
Auswirkung von Nichtidealitäten auf den Ablauf von Folgereaktionen in Rohrraktoren (online verfügbar)
Betreuer: Prof. Platzer
2008-05-26 Schütze, Jens
Grundlagen und Ansätze zur Modellierung von Kommunikationsprozessen in KMU-Netzwerken
Betreuer: Prof. Müller
2008-05-26 Mücklich , Silke
Leichtbaupotenziale durch Einsatz von Leichtmetallen Fachgebiet: Werkstofftechnik (online verfügbar)
Betreuer: Prof. Wielage
2008-05-26 Lampke , Thomas
Gestaltung techn.Oberflächen mit funktionalen AufgabenFG: Werkstofftechnik und Oberflächentechnik
Betreuer: Prof. Wielage
2008-05-14 Einhaus, Marco
Beitrag zur Verbesserung des Sicherheitsstandards bei seilunterstützten Arbeitsverfahren im internationalen Vergleich
Betreuer: Prof. Spanner- Ulmer
2008-05-13 Gelbrich, Sandra
Beitrag zur Entwicklung von Krafteinleitungselementen für hochbeanspruchte Faserverbund-Zugstreben im Bauwesen
Betreuer: Prof. Kroll
2008-05-07 Horbach, Sebastian
Modulares Planungskonzept für Logistikstrukturen und Produktionsstätten kompetenzzellenbasierter Netze
Betreuer: Prof. Müller
2008-04-30 Raupach, Annett
Ergonomische Gestaltung multimedialer Arbeitsmittel
Betreuer: Prof. Spanner-Ulmer/Prof. Enderlein
2008-03-12 Tran , Thanh Ngoc
Limit and Shakedown Analysis of Plates and Shells Including Uncertainties (online verfügbar)
Betreuer: Prof. Kreißig
2008-03-07 Reinstettel, Marc
Laboruntersuchung zur Prozessstabilität beim Niet-Clinchen (online verfügbar)
Betreuer: Prof. Neugebauer
2008-02-20 Enge, Holger
Methodische Ansätze zur Verbesserung der Integration des Service in den Produktlebenszyklus von Automobilen
Betreuer: Prof. Müller
2008-02-19 Reiche, Michael
Referenzmodellierung technologischer Hauptprozesse der grafischen Industrie (online verfügbar)
Betreuer: Prof. Hübler
2008-02-15 Koca, Matthias
Untersuchungen zur Temperaturabhängigkeit des Formänderungsvermögens unter Beachtung des hydrostatischen Spannungszustandes
Betreuer: Prof. Naumann
2008-02-14 Gieschen, Katja
Kaizenorientierte Ablauforganisation am Beispiel schlanker Montagesysteme
Betreuer: Prof. Müller
2008-02-11 Rahm, Jens
Herstellung langfaserverstärkter Aluminium-Matrix-Verbundwerkstoffe durch Anwendung der Prepregtechnik (online verfügbar)
Betreuer: Prof. Wielage
2008-02-07 Stanková, Hana
Einfluss der inkrementellen Deformationen bei der thermomechanischen Behandlung auf die Eigenschaften von TRIP Stählen (online verfügbar)
Betreuer: Prof. Meyer
2007-12-14 Gerber, Anna
Methode zur Konzeption eines unternehmerspezifischen Qualitätsinformationssystems für kleinere Unternehmen (online verfügbar)
Betreuer: Prof. Dietzsch
2007-12-13 Schumann, Mathias
Zur Bestimmung der Umschlagleistung von Hochregallagern unter besonderer Berücksichtigung der Lagerorganisation (online verfügbar)
Betreuer: Prof. Nendel
2007-12-06 Hensel, Sven
Modellierung und Optimierung von Werkzeugmaschinen mit parallelkinematischen Strukturen
Betreuer: Prof. Neugebauer
2007-12-03 Krüger, Wilfried
Theoretische und empirische Beiträge zur Fabrikplanung unter dem Aspekt des demografischen Wandels
Betreuer: Prof. Müller
2007-11-30 Schmiedl, Nadja
Methodik zur prozessorientierten Restrukturierung von Arbeitssystemen
Betreuer: Prof. Spanner-Ulmer
2007-11-12 Ortmann, Sebastian
Herstellung von Blechdurchzügen (Kragen) in IHU-Bauteilen mit Hilfe von flüssigem Druckmedium
Betreuer: Prof. Neugebauer
2007-10-24 Matz, Detlef
Methode der logistischen Werkstruktur-Überplanung für Anlagen zur Herstellung von Fließgütern
Betreuer: Prof. Wirth
2007-09-05 Ackermann, Jörg
Modellierung, Planung und Gestaltung der Logistikstrukturen kompetenzzellenbasierter Netze (online verfügbar)
Betreuer: Prof. Müller
2007-08-07 Gumpoltsberger, Gerhard
Systematische Synthese und Bewertung von mehrgängigen Planetengetrieben
Betreuer: Prof. Tenberge
2007-07-25 Schröder, Thomas
Entwicklung und Evaluation von Algorithmen zur zeitoptimierten Bewegungszerlegung bei kinematisch redundanten Werkzeugmaschinen
Betreuer: Prof. Neugebauer
2007-07-17 Herold, Katrin
Entwicklung von standardisierten Prozessbausteinen für seilunterstützte Rettungs- und Bergeprozesse (online verfügbar)
Betreuer: Prof. Spanner-Ulmer
2007-07-13 Wucherer, Marc
Beitrag zur produktionstechnischen Gestaltung in Niedriglohnländern dargelegt am Fallbeispiel einer Elektronikproduktion in China
Betreuer: Prof. Müller
2007-07-05 Gröger, Sophie
Beitrag zum ganzheitlichen Bewerten von geometrischen Strukturen mit Tastschnittgeräten bis in den Nanometerbereich (online verfügbar)
Betreuer: Prof. Dietzsch
2007-06-26 Kondapalli , Satyanarayana
Oberflächenmodifikation von Aluminium-Bauteilen durch Entwicklung von Verbundbeschichtungen mit Hilfe des Plasma-Pulver-Auftragschweißprozesses
Betreuer: Dr.-Ing.habil. F. Riedel
2007-06-15 Wilhelm, Gerald
Quantitative Optimierung des Energieeintrags beim MSG-Hochleistungsschweißen nichtrostender Stähle
Betreuer: Prof. Matthes
2007-05-18 Weiß, Jörg
Modellbildung und Simulation radial gekoppelter Rotoren (online verfügbar)
Betreuer: Prof. Dresig
2007-04-27 Khadjavi (m), Armin Fazlollah
Ein Beitrag zur statischen Aeroelastik des Windkraftanlagenrotorblattes (online verfügbar)
Betreuer: Prof. Wozniak
2007-04-26 Näser, Peggy
Methode zur Entwicklung und kontinuierlichen Verbesserung des Anlaufmanagements komplexer Montagesysteme
Betreuer: Prof. Müller
2007-04-24 Mucha, Herbert
Untersuchungen zur Porositätsentwicklung von Phenolharzen als polymere Kohlenstoffspendermatrices in C-Faserverbundwerkstoffen
Betreuer: Prof. Wielage
2007-04-23 Ehrenheim, Christoph
Produktions- und Prozessoptimierung mit Hilfe von Kennzahlensystemen
Betreuer: Prof. Müller
2007-01-24 Shalaby, Hemdan
On the potential of large eddy simulation to simulate cyclone separators (online verfügbar)
Betreuer: Prof. Wozniak
2007-01-19 Roth, Stefan
Spritzgegossene Abschirmgehäuse aus stahlfasergefüllten Thermoplasten - Materialeigenschaften, Verarbeitung und Gestaltung (online verfügbar)
Betreuer: Prof. Mennig
2007-01-09 Wittstock, Volker
Piezobasierte Aktor-Sensor-Einheiten zur uniaxialen Schwingungskompensation in Antriebssträngen von Werkzeugmaschinen
Betreuer: Prof. Neugebauer
2006-12-18 Löschmann, Frank
Anlagentechnische Grundlagen für die Elektromagnetumformung im Automobilbau
Betreuer: Prof. Neugebauer
2006-12-12 Dietrich, Stephan
Grundlagenuntersuchungen zu neuen matrizenlosen Umformfügeverfahren
Betreuer: Prof. Neugebauer
2006-12-11 Ecke, Ramona
Abscheidung (CVD) und Charakterisierung W-basierter Diffusionsbarrieren für die Kupfermetallisierung
Betreuer: Prof. Wielage
2006-12-01 Forbrig, Frank
Untersuchungen zur Gestaltfestigkeit von Passfederverbindungen
Betreuer: Prof. Leidich
2006-11-28 Klaffert, Thomas
Selbstoptimierende HSC-Motorspindel
Betreuer: Prof. Neugebauer
2006-11-24 Liepack, Otfrid
Anwendung des Systems Engineering zur Verbesserung des Betriebes von planetaren Missionen
Betreuer: Prof. Müller
2006-11-17 Steiner, Ralf
Kompetenzzellenbasierte Produktentwicklung (online verfügbar)
Betreuer: Prof. Neugebauer
2006-10-24 Martens, Knut
Werkzeugwechselkonzepte für Bearbeitungszentren mit kurzer Werkzeugeingriffszeit
Betreuer: Prof. Neugebauer
2006-10-13 Thiele, Reiko
Untersuchungen zur Zahnfußbeanspruchung von Schneckenrädern und Entwicklung eines Tragfähigkeitsnachweises auf der Basis der Zahnfußschädigungshypothese
Betreuer: Prof. Leidich
2006-09-29 Patcharaphun (m), Somjate
Characterization and Simulation of Material Distributation and Fiber Orientation in Sandwich Injection Molded Parts
Betreuer: Prof. Mennig
2006-08-16 Banik (m), Kaushik
Prozessinduziertes Langzeitdeformationsverhalten von spritzgegossenen teilkristallinen Kunststoffen
Betreuer: Prof. Mennig
2006-07-20 Manuelli, Alessandro
Influences of printing techniques on the electrical performances of conjugated polymers for organic transistors
Betreuer: Prof. Hübler
2006-07-06 Ufer, René
Modellierung und Simulation von Drückwalzprozessen
Betreuer: Prof. Awiszus
2006-07-03 Li (m), Bincheng
Analyse und Simulation des Transversalschwingungseinflusses von Riemengetrieben auf Fehler der Werkstückoberfläche
Betreuer: Prof. Neugebauer
2006-06-23 Seitz, Bernhard
Optimierung der technischen Unternehmensführung mittels gewichteter Kennzahlen für klein- und mittelständische Unternehmen der Lackindustrie
Betreuer: Prof. Müller
2006-06-23 Panhans, Sonja
Ein viskoplastisches Materialmodell mit nichtquadratischer Fließfunktion
Betreuer: Prof. Kreißig
2006-06-08 Gäbel, Kai
Beitrag zur Inbetriebnahme von Antrieben mechatronischer Produktionsmaschinen als internetbasierte Dienstleistung
Betreuer: Prof. Heß
2006-05-29 Helbig, Frank
Gestaltungsmerkmale und mechanische Eigenschaften druckelastischer Abstandsgewirke
Betreuer: Prof. Köhler
2006-04-27 Shawky (m), Abdel Malek
Verformungs- und Versagensverhalten ausgewählter niedrig legierter Stähle unter Variation von Temperatur, Verformungsgeschwindigkeit und Spannungszustand
Betreuer: Prof. Meyer
2006-04-12 Brunotte, René
Die thermodynamischen und verfahrenstechnischen Abläufe der in-situ-Oberflächenmodifizierung beim Spritzgießen
Betreuer: Prof. Mennig
2006-03-31 Dimitrova, Krassimira Georgieva
Thermische Effekte im Kollektorfeld solarthermischer Anlagen
Betreuer: Prof. Platzer
2006-03-30 Wu (w), Jingyan
Systematische Untersuchung der Einflüsse von Temperaturdifferenzen auf den Reaktionsablauf in Rohrreaktoren
Betreuer: Prof. Platzer
2006-03-24 Auerbach, Peter
Zur Beanspruchung und Lebensdauer raumgängiger Gleitketten aus Kunststoffen
Betreuer: Prof. Nendel
2006-02-24 Rolle, Thomas
Die Entwicklung einer Technologie zur Herstellung von Verbundmaterial aus Getreidekleie
Betreuer: Prof. Nendel
2006-02-09 Lässig, Jörg
Gestaltungslösung für die Dienstleistungsfabrik Montage
Betreuer: Prof. Wirth
2006-01-27 Leiser, Jörg
Beitrag zu innovativen Verbindungstechniken für Hochleistungsverbundwerkstoffe
Betreuer: Prof. Köhler
2006-01-27 Friedrich, Frank
Beitrag zur Entwicklung von neuen Traglaschenketten in der Fördertechnik
Betreuer: Prof. Nendel
2006-01-26 Ohmann, Ulf
Aerobe Reinigung und anaerobe Entfärbung von Abwässern der Textilveredlungsindustrie
Betreuer: Prof. Platzer
2006-01-13 Kreißig, Udo
Entwicklung und Evaluation eines Beurteilungsverfahrens für handgehaltene, motorisch angetriebene Schlagwerkzeuge
Betreuer: Prof. Enderlein
2005-12-12 Chenping (m), Jia
Mikromechanischer Ultraschallwandler aus Silizium - Silicon Micromachines Ultrasonic Transducers
Betreuer: Prof. Hübler
2005-12-02 Todtermuschke, Marcel
Verfahrensoptimierung zur Herstellung einer punktförmigen, mechanisch gefügten, einseitig ebenen Verbindung ohne Verbindungselement
Betreuer: Prof. Matthes
2005-11-29 Yu (m), Du
Zur Optimierung des dynamischen Verhaltens von Gesamtfahrzeugen mit mechatronischen Komponenten
Betreuer: Prof. Maißer
2005-11-24 Hodic, Ludek
Entwicklung der Zeitdaten-Backend-Methode für die mathematische Verarbeitung betrieblicher Prozessdaten zu Planzeiten
Betreuer: Prof. Enderlein
2005-11-24 Günther, Uwe
Methodik zur Struktur- und Layoutplanung wandlungsfähiger Produktionssysteme
Betreuer: Prof. Wirth
2005-10-26 Riedel, Ralph
Heuristik zur Gestaltung ganzheitlicher Anreizsysteme aus soziotechnischer Sicht
Betreuer: Prof. Enderlein
2005-10-26 Hellfritzsch, Udo
Optimierung von Verzahnungsqualitäten beim Walzen von Stirnradverzahnungen
Betreuer: Prof. Neugebauer
2005-10-04 Kühnert, Ines
Grenzflächen beim Mehrkunststoff-Spritzgießen
Betreuer: Prof. Mennig
2005-09-29 Beckmann, Reinhold
Beitrag zur Auslegung und Konstruktion von Balligzahn-Kupplungen
Betreuer: Prof. Tenberge
2005-09-19 Dörffel, Claudia
Restabfallmengen aus privaten Haushalten in Sachsen - Entwicklung eines abfallwirtschaftlichen Simulations- und Prognosemodells
Betreuer: Prof. Platzer
2005-09-13 Sterzing, Andreas
Bewertung von Leichtbaupotential und Einsatzfähigkeit wölbstrukturierter Feinbleche
Betreuer: Prof. Neugebauer
2005-09-07 Scholta, Claudia
Erfolgsfaktoren unternehmensübergreifender Kooperation am Beispiel der mittelständischen Automobilzulieferindustrie in Sachsen
Betreuer: Prof. Enderlein
2005-08-26 Wenyong (m), Li
Aktive Dämpfung und Kompensation von Rotorschwingungen über aktive Piezo-Stapel-Aktuator-Lager
Betreuer: Prof. Maißer
2005-08-23 Hoyer, Ina
Beitrag zur Entwicklung von Hochtemperaturloten auf Eisenbasis
Betreuer: Prof. Wielage
2005-06-28 Wieland, Petra
Ein Beitrag zur Gestaltung der Spanentsorgung bei der Trockenbearbeitung
Betreuer: Prof. Neugebauer
2005-06-24 Schimanz, Barbara
Modellierung und experimenteller Nachweis von Zusammenhängen zwischen Parametern des Vernadelns, der Faseroberfläche und des Porenvolumens von dreideimensionalen Vliesstoffen
Betreuer: Prof. Köhler
2005-06-03 Neubauer, Werner
Gestaltung und Evaluation eines Mitarbeiter-Management-Informationssystems in der Montage eines Automobilwerkes
Betreuer: Prof. Enderlein
2005-05-26 Halle, Thorsten
Zusammenhänge zwischen Spanvorgängen und dem mechanischen Werkstoffverhalten bei hohen Dehnungsgeschwindigkeiten
Betreuer: Prof. Meyer
2005-05-25 Mücklich, Silke
Beitrag zum flussmittelfreien Löten von Magnesiumwerkstoffen mit angepassten Lötwerkstoffen
Betreuer: Prof. Wielage
2005-05-03 Freitag, Thomas
Entwicklung eines Natrium-Trihydrat Latentwärmespeichers mit einem Wärmeübertrager aus Kunststoffmetallverbund-Kapillarrohr
Betreuer: Prof. Platzer
2005-04-29 Olschewski, Torsten
Methode zur Gestaltung von flexibilitäts-stufenbasierten Fabrikplattformen
Betreuer: Prof. Wirth
2005-04-22 Bruzek , Bohumil
Untersuchungen zum Einfluss einer Passfederverbindung auf die Übertragungsfähigkeit von verzahnten dünnwandigen Naben
Betreuer: Prof. Leidich
2005-04-18 Hildebrand, Torsten
Theoretische Grundlagen der bausteinbasierten, technischen Gestaltung wandlungsfähiger Fabrikstrukturen nach dem Plug-Produce-Prinzip
Betreuer: Prof. Wirth
2005-03-16 Schulz, Rüdiger
Simulationsintegrierte Grobplanung von Montagesystemen für die Serienmontage am Beispiel der Automobilzulieferindustrie
Betreuer: Prof. Wirth
2005-03-04 Schultetus, Wolfgang
Praxisrelevanz arbeitswissenschaftlicher Erkenntnisse unter besonderer Berücksichtigung der Anforderungen an die produzierenden Unternehmen und des Nutzens hinsichtlich der Wirtschaftlichkeit
Betreuer: Prof. Enderlein
2005-02-18 Göppert, Stefan
Wärmeübertragung an einer ebenen Platte bei Anströmung durch instationäre Prallstrahlen
Betreuer: Prof. Platzer
2005-02-11 Lang, Heiko
Beitrag zum Fügen hochporöser metallischer Werkstoffe mittels prositätsbildender Zusatzwerkstoffe am Beispiel des Hartlötens von Aluminiumschaum
Betreuer: Prof. Matthes
2005-02-10 Hofbeck, Christoph
Entwicklung einer Methode für die Planung von Projekten unter Anwendung des kompetenzzellenbasierten Vernetzungsansatzes
Betreuer: Prof. Petermann
2005-02-07 Sager, Marion
Entwicklung einer Methodik zur Gestaltung von (flexiblen) Arbeitszeitsystemen
Betreuer: Prof. Enderlein
2005-01-24 Zimmer, Egbert
Bedienbarkeit von Fertigungseinrichtungen
Betreuer: Prof. Enderlein
2005-01-21 Lorenz, Ivo
Beitrag zu multifunktionalen Hohlfaser-Verbundsystemen
Betreuer: Prof. Köhler
2005-01-20 Lösel, Wolfgang
Methode zur Revitalisierung, Modernisierung und Umnutzung von Industriebrachen
Betreuer: Prof. Wirth
2004-12-23 Müller, Andreas
Singuläre Phänomene in der Kinematik von Starrkörpermechansimen - Mathematische Modellierung und lokale Analyse
Betreuer: Prof. Maißer
2004-12-14 Tassi, Endre
Knowledge-Features für die Produkt- und Technologieentwicklung in umformtechnischen Prozessketten
Betreuer: Prof. Neugebauer
2004-12-13 Müller, Markus
Beitrag zur Herstellung von Strukturen aus gerichteten Gelegen mit thermoplastischer Stapelfaserverstärkung
Betreuer: Prof. Köhler
2004-12-10 Kolbe, Gerald
Beitrag zur Erhöhung der Verschleißbeständigkeit von Bauteilen aus TiAl6V4-durch Dispergieren/Legieren mit Diboriden
Betreuer: Prof. Matthes
2004-10-29 Heinrich, Steffen
Operative technisch-organisatorische Planung und Steuerung der spanenden Teilefertigung mit holonischen Merkmalen
Betreuer: Prof. Dürr
2004-10-15 Sicre, Benoit
Nachhaltige Energieversorgung von Niedrigstenergiehäusern auf Basis der Kraft-Wärme-Kopplung im Kleinstleistungsbereich und der Solarthermie
Betreuer: Prof. Platzer
2004-10-11 Schmieder, Marcel
Untersuchung zur Übertragbarkeit der kompetenzzellenbasierten Vernetzungstheorie auf die variantenreiche Serienproduktion
Betreuer: Prof. Wirth
2004-10-04 Riedel , Frank
Habilitation!Möglichkeiten der Optimierung von punktförmigen, form- und kraftschlüssigen Feinblechverbindungen
Betreuer: Prof. Matthes
2004-09-22 Mehnert, Jens
Gestaltung und Integration von Arbeitsplanungskompetenzen für hierarchielose Produktionsnetze
Betreuer: Prof. Dürr
2004-07-23 Sedlacik, Gert
Beitrag zum Einsatz von unidirektionalnaturfaserverstärkten thermoplastischen Kunststoffen als Werkstoff für großflächige Strukturbauteile
Betreuer: Prof. Köhler
2004-07-20 Weiß, Uwe
Einsatz neuer Materialsysteme für Niedrigenergie Anzündelemente in Airbagsystemen
Betreuer: Prof. Wielage
2004-07-13 Steffani, Katharina
Mesoskopische Modellierung von Ausbreitungsmechanismen in Rohren und Kanälen zur Berechnung von Verweilzeitverteilungen
Betreuer: Prof. Platzer
2004-07-09 Pachler, Klaus
Parallele Berechnung 3-dimensionaler, instationärer Gas-Partikel-Strömungen unter Berücksichtigung von Kollissionen und Aggregatzuständen
Betreuer: Prof. Platzer
2004-07-05 Mahn, Uwe
Erweiterung der Einsatzgrenzen beim Spannen hochbelasteter, langgestreckter Werkstücke
Betreuer: Prof. Neugebauer
2004-06-28 Roßmann, Thomas
Entwicklung und Validierung eines Messverfahrens zur Bestimmung der Geruchsausbreitung im bodennahen Bereich
Betreuer: Prof. Platzer
2004-06-02 Schmeißer, Swen
Beitrag zu offenen Automatisierungsnetzen am Beispiel eines Web-basiserten Labors Automatisierungstechnik
Betreuer: Prof. Heß
2004-05-17 Thielen, Michael
Book-on-Demand: Entwicklung eines Konzepts zur Integration zur Buchweiterverarbeitung in einen digitalen Workflow
Betreuer: Prof. Hübler
2004-05-17 Zimniak, Joachim
Analyse von Grundprozessen der Aufbereitung von Kompositwerkstoffen aus ausgewählten Kunststoff- und Gummiabfällen
Betreuer: Prof. Mennig
2004-04-26 Schuster , Jochen
Theoretische Beschreibung der Heißrissanfälligkeit metallischer Werkstoffe unter besonderer Berücksichtigung hochlegierter Stähle und Nickellegierungen
Betreuer: Prof. Matthes
2004-04-23 Zhao (m), Xueyong
Simulation des dynamischen Verhaltens einer Windenergieanlage als mechatronisches System
Betreuer: Prof. Maißer
2004-04-15 Jurklies, Ines
Generierung und Bewertung von Prozessketten für den Werkzeug- und Formenbau
Betreuer: Prof. Dürr
2004-04-05 Urbaneck, Thorsten
Berechnung des thermischen Verhaltens von Kies-Wasser-Speichern
Betreuer: Prof. Platzer
2004-03-22 Zhang (m), Tong
Energieertrag und dynamische Belastungen in einer Windkraftanlage mit stufenlosem leistungsverzweigtem Getriebe bei aktiver Dämpfung
Betreuer: Prof. Tenberge
2004-01-19 Kader (m), Magdy Abd El
Application of Hot-melt Inkjet Processes for Imaging at Offset Printing Form Cylinder
Betreuer: Prof. Hübler
2004-01-09 Klose, Lutz
Einsatzplanung von Mehrpunktziehanlagen auf einfach wirkenden Pressen
Betreuer: Prof. Neugebauer
2003-07-01 Bergner , Andreas
Betreuer: Prof. Köhler
2002-12-06 Ziaei , Masoud
Betreuer: Prof. Leidich
2002-07-21 Frank , Thomas
Betreuer: Prof. Platzer
