Navigation

Springe zum Hauptinhalt
Fakultät für Maschinenbau
Promotion / Habilitation


Promotion und Habilitation


Sehr geehrte Damen und Herren,

vielen Dank für Ihre Interesse an einer Promotion bzw. einer Habilitation an der Fakultät für Maschinenbau der TU Chemnitz. Auf dieser Seite finden Sie alle benötigen Informationen zum Promotionsverfahren. Bei Fragen wenden Sie sich bitte an folgenden Ansprechpartner. Vielen Dank.
Portrait: Kerstin Hensel
Kerstin Hensel

Allgemeines

Sehr geehrte Promovenden,

trotz der aktuell etwas schwierigen Situation wollen wir die Promotionsvorhaben weiterhin vorantreiben um nicht zu viel Zeit zu verlieren. Der Promotionsausschuss hat daher in Abstimmung mit dem Dekan entschieden, dass sowohl Zulassungen zur Promotion, als auch Verfahrenseröffnungen zusätzlich zu Annahmen weiterhin zulässig sind und bearbeitet werden. Dies erfolgt in einem schriftlichen Verfahren auf Basis ausschließlich elektronisch eingereichter Dokumente.

Verteidigungen werden zur Zeit per Videokonferenz durchgeführt. >>> Mehr Informationen <<<

Um eine effektive Behandlung der Vorgänge durch den Promotionsausschuss zu gewährleisten, sind die Vorgänge ausschliesslich elektronisch (im PDF-Format) einzureichen. Eine ggf. spätere Kontrolle der Originaldokumente bleibt davon unberührt.

1. Antrag auf Zulassung:
Der Promovend muss sich als erstes wie gehabt in das Zulassungsportal eintragen: >>> Zum Zulassungsportal <<<

Als zweiter Schritt sind alle Zulassungsdokumente in einer PDF-Datei zusammengefasst an promotion@... per E-Mail zu schicken.
- Der Betreff lautet: Vorname Name, Antrag auf Zulassung zur Promotion
- Der Dateiname lautet: Promotion_Antrag_Zulassung_Vorname_Nachname.pdf (Umlaute sind zu vermeiden)

2. Antrag auf Eröffnung des Verfahrens:
Die Verfahrenseröffnung erfolgt aktuell ausschliesslich elektronisch. Der Antrag ist mit drei PDF-Dateien ebenfalls per E-Mail (in einer E-Mail) einzureichen.
- Der Betreff lautet: Vorname Name, Antrag auf Eroeffnung des Promotionsverfahrens

Die 1. Datei enthält die Antragsformulare und alle zusätzlichen Dokumente.
- Der Dateiname lautet: Promotion_Antrag_Eroeffnung_Vorname_Nachname.pdf (Umlaute sind zu vermeiden)

Die 2. Datei enthält die Kurzfasssung.
- Der Dateiname lautet: Promotion_Kurzfassung_Vorname_Nachname.pdf (Umlaute sind zu vermeiden)

Die 3. Datei enthält die Dissertation.
- Der Dateiname lautet: Promotion_Dissertation_Vorname_Nachname.pdf (Umlaute sind zu vermeiden)

Alle Dateien sind bitte in einer sinnvollen Größe bis jeweils maximal 20 MB einzureichen (wegen des E-Mail Versands). Sollte die Datei unbedingt diese Größe überschreiten müssen, bitte direkt Kontakt mit Frau Hensel aufnehmen.

Sollten die Gutachter eine Papierversion der Dissertation bevorzugen, ist diese vom Promovenden selbst an den Gutachter zuzustellen. Die Fakultät wird den Gutachtern die elektronische Version zusenden. Bitte darauf achten, dass im Eröffnungsantrag gültige E-Mail-Adressen der Gutachter vermerkt sind.

In Papier eingereichte Anträge können bis auf weiteres leider nicht bearbeitet werden. Wir bitten dafür um Verständnis.

Für Rückfragen per E-Mail steht der Promotionsausschuss selbstverständlich gern zur Verfügung.

Beste Grüße und bleiben Sie gesund
Birgit Awiszus
-----------------------------------------------------------------------------------
Prof. Dr.-Ing. Birgit Awiszus
Vorsitzende des Promotions- u. Habilitationsausschusses

Zunächst müssen Sie für eine Promotion bzw. Habilitation vom Promotionsausschuss zugelassen werden. Hierzu müssen Sie folgende Schritte durchführen:

  1. Anmeldung zur Promotion über unser Online-Formular "Zulassung zur Promotion"
  2. Anschließende Einreichung aller benötigten Unterlagen (gemäß Promotionsordnung §7 (siehe Bereich Downloads)
Nach der Anmeldung über das Online-Formular bekommen Sie eine E-Mail mit der Sie weitere Informationen bekommen.

(Der Promovend hat Bringepflicht - nicht vollständig eingereichte Anträge werden nicht bearbeitet!)

Der Antrag auf Zulassung zur Promotion ist schriftlich an die Vorsitzende des Promotionsausschusses, Frau Prof. Awiszus, der Fakultät zu richten.

Technische Universität Chemnitz
Vorsitzende des Promotionsausschusses
Fakultät für Maschinenbau
09107 Chemnitz

Bei der Beantragung zur Eröffnung eines Promotionsverfahrens (Abgabe der Dissertation) gilt unabhängig von der Ordnung nach der der Promovend zugelassen wurde, §8 der aktuellen Ordnung (siehe Bereich "Downloads").

Hier geht es zu den Grundsätzen zur Sicherung guter wissenschaftlicher Praxis und für das Verhalten bei Verdacht auf wissenschaftliches Fehlverhalten: >>> Klick <<<

Für die Eröffnung von Promotionsverfahren können die entsprechenden vollständigen Unterlagen immer bis zu den Treffen des Promotionsausschusses eingereicht werden, entweder im Büro des Dekans (UT Reichenhainer Str, Raum A025), oder per Post an die Vorsitzende. Eine spätere Annahme ist aus organisatorischen Gründen nicht möglich. Arbeiten oder Dokumente, die nach dem genannten Termin abgegeben werden, können erst in der darauffolgenden Sitzung berücksichtigt werden.

Datum: bis 17.02.21 - Zeit: 14.00 Uhr
Datum: bis 17.03.21 - Zeit: 14.00 Uhr

In diesem Zeitfenster können auch andere Fragen betreffs Promotion beantwortet werden.

Promotionsausschuss der Fakultät für Maschinenbau


  • Prof. Dr. Birgit Awiszus (Vorsitz)
  • Prof. Dr. Sophie Gröger
  • Prof. Dr. Alexander Hasse
  • Prof. Dr. Guntram Wagner
  • Prof. Dr. Michael Groß

Verteidigte Promotionen an der Fakultät für Maschinenbau, chronologisch, seit 2003


2020-12-21 Vogt, Lorenz
Additive Fertigung von Keramiken mittels Mikrofluidik und elektrophoretischer Abscheidung
Betreuer: Prof. Dr. Guntram Wagner
2020-11-04 Leibelt, Jan
Strukturingegrierte Textilsensorik für neuartige Füllstandsmesssysteme
Betreuer: Prof. Dr. Lothar Kroll
2020-10-23 Frieß, Uwe
Eigenschaftsabsicherung on Werkzeugmaschinen mittels adaptiver Algorithmen auf Basis gleichartiger Systemzustände
Betreuer: Prof. Dr. Reimund Neugebauer
2020-09-24 Landgraf, geb. Schulze, Pierre
Gefüge- und Härteentwicklung bei der Laserstrahlbehandlung von hochlegierten Werkzeugstählen
Betreuer: Prof. Dr. Thomas Lampke
2020-09-18 Reiß, Friedemann
Modellprüfverfahren zur Ermittlung realer Haftreibwerte von gefügten Maschinenelementen
Betreuer: Prof. Dr. Erhard Leidich
2020-09-04 Uhrig, Florian
Bewertung von effizienzsteigernden Maßnahmen mit der verschachtelten Optimierung für automobile Brennstoffzellenantriebe
Betreuer: Prof. Dr. Thomas von Unwerth
2020-08-24 Voigt, geb. Wulfken, Barbara Theresia
Generisches Referenzmodell zur Mitarbeiterentwicklung
Betreuer: Prof. Dr. Egon Müller
2020-07-24 Wirnsperger, Franz
Laserstrahltiefschweißen hochfester Feinkornbaustähle in der Serienproduktion (online verfügbar)
Betreuer: Prof. Dr. Peter Mayr
2020-07-14 Wabner, Markus
Funktionalitätsverbesserung von spanenden Werkzeugmaschinen durch additive mechatronische Systeme (online verfügbar)
Betreuer: Prof. Dr. Welf-Guntram Drossel
2020-07-08 Winter, Lisa
Schwingfestigkeit und Mittelspannungsempfindlichkeit der Legierung AlMgSi1 nach hochgradig plastischer Umformung und anodischer bzw. plasma-elektrolytischer Oxidation
Betreuer: Prof. Dr. Thomas Lampke
2020-06-23 Bauer, Alexander
Experimentelle und numerische Untersuchungen zur Analyse der umformtechnischen Herstellung metallischer Bipolarplatten (online verfügbar)
Betreuer: Prof. Dr. Birgit Awiszus
2020-05-07 Zipplies, Daniel
Effizienzsteigerung des Kunststoffblasformprozesses durch Optimierung des Drucklufteinsatzes (online verfügbar)
Betreuer: Prof. Dr. Bernd Platzer
2020-04-17 Knöfel, Björn
Potential und Grenzen der akustischen EOL-Fahrzeug-Korrelation am Beispiel eines Pkw-Getriebes unter Anwendung verschiedener Methoden der deskriptiven Statistik
Betreuer: Prof. Dr. Welf-Guntram Drossel
2020-03-05 Menzel, Christoph
Technologieentwicklung zur großserientauglichen Herstellung automobiler Interieur-Bauteile in neuartiger Sandwichbauweise (online verfügbar)
Betreuer: Prof. Dr. Lothar Kroll
2020-02-21 Hädrich, Juliane
Zustandsgrößenerfassung von nachgiebigen Strukturen durch Multi-Sensor-Datenfusion
Betreuer: Prof. Dr. Reimund Neugebauer
2020-02-20 Gießmann, geb. Pouya, Mina
Finite element modeling of complex stress states and tension/compression asymmetry in NiTi shape memory alloys
Betreuer: Prof. Dr. Martin Wagner
2020-02-05 Schubert, Christine
Untersuchungen an Einschraubverbindungen für hochgefüllte, extrudierte Holz-Polymer-Werkstoffe zum Einsatz in der Fördertechnik (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2019-12-20 Scherzer, Robert
Modellierung und mehrstufige Simulation der Herstellung plastisch gefügter Welle-Nabe-Verbindungen
Betreuer: Prof. Dr. Jörn Ihlemann
2019-12-19 Kimme, Simon
Simulation des Wälzschleifens und dessen Einfluss auf die Flankentopografie und Verzahnungsakustik
Betreuer: Prof. Dr. Welf-Guntram Drossel
2019-12-18 Trautmann, Maik
Beschichtung von Kohlenstoffeinzelfasern für die Funktionalisierung von Faser-Kunststoff-Verbunden
Betreuer: Prof. Dr. Guntram Wagner
2019-12-18 Blank, Robin
Entwicklung von HT-Lötsystemen für artfremde Werkstoffverbunde (online verfügbar)
Betreuer: Prof. Dr. Guntram Wagner
2019-12-17 Kießling, Robert
Modellierung des Verhaltens der Komponenten eines intrinsischen Hybridverbundes (online verfügbar)
Betreuer: Prof. Dr. Jörn Ihlemann
2019-12-10 Hauschild, Sven
Reibdauerbeanspruchte Stahl-Kontakte - Auslegung und Bewertung mittels systemspezifischer Reibkorrosionsfaktoren (online verfügbar)
Betreuer: Prof. Dr. Erhard Leidich
2019-12-03 Tran, Ngoc Tu
Creating material properties for thermoset injection molding simulation process (online verfügbar)
Betreuer: Prof. Dr. Michael Gehde
2019-11-29 Kanzenbach, Lars
Experimentell-numerische Vorgehensweise zur Entwicklung von Probekörper-Setups für die Charakterisierung technischer Elastomere (online verfügbar)
Betreuer: Prof. Dr. Jörn Ihlemann
2019-11-26 Mücke, Jan
Experimentelle Bestimmung der effektiven Wärmeleitfähigkeit schüttfähiger Wärmedämmstoffe für thermische Energiespeicher (online verfügbar)
Betreuer: Prof. Dr. Bernd Platzer
2019-11-22 Schmidt, Manfred
Entwicklung einer Methodik zur Bewertung der Flexibilität von Prozessen in Produktionssystemen
Betreuer: Prof. Dr. Sophie Gröger
2019-11-15 Bäume, Tobias
Prozessregelungen piezoelektrisch erweiterte Umformwerkzeuge (online verfügbar)
Betreuer: Prof. Dr. Welf-Guntram Drossel
2019-10-25 Schmieder, Annett
Schadensanalyse von hochfesten, laufenden Faserseilen (online verfügbar)
Betreuer: Prof. Dr. Markus Golder
2019-10-11 Krumm, Dominik
Methodische Aspekte bei der Entwicklung mechanischer Simulation zur Messung der Funktionalitäten eines Handballschuhs (online verfügbar)
Betreuer: Prof. Dr. Stephan Odenwald
2019-10-07 Morgenstern, Roy
Anodische Oxidation von kupferhaltigen Aluminiumlegierungen (online verfügbar)
Betreuer: Prof. Dr. Thomas Lampke
2019-09-27 Krüger, Dennis
Entwicklung von Systemintegration einer Mikro-Kraft-Wärme-Kopplungs-Anlage für feste Biomasse (online verfügbar)
Betreuer: Prof. Dr. Bernd Platzer
2019-09-26 Roudini, Mehrzad
Experimental Investigation of Spray Characteristics of Prefilming Airblast Atomizers (online verfügbar)
Betreuer: Prof. Dr. Günter Wozniak
2019-09-16 Kirchner, Philipp
Fördertechnisches Gesamtsystem für eine automatisierte und flexible Fahrzeug-Fertigung (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2019-09-13 Silbermann, Christian
Modellierung versetzungs- und verformungsinduzierter plastischer Lokalisierungsphänomene (online verfügbar)
Betreuer: Prof. Dr. Jörn Ihlemann
2019-08-29 Choudry, Saphir Ahmad
Multidimensionale Bewertung von Fügetechnologien-Entwicklung einer Auswahlmethodik zur optimierten Entscheidungsfindung im Karosseriebau (online verfügbar)
Betreuer: Prof. Dr. Welf-Guntram Drossel
2019-08-23 Kirbach, Carola
Untersuchungen zum mechanischen Verhalten von Aluminium/Magnesium-Werkstoffverbunden und deren Grenzschicht bei der weiteren Umformung (online verfügbar)
Betreuer: Prof. Dr. Jörn Ihlemann
2019-08-22 Schleicher, Tim
Instruktion von kollaborierenden Robotern - Gestaltungsempfehlungen für gebrauchstaugliche Mensch-Roboter-Schnittstellen
Betreuer: Prof. Dr. Angelika Bullinger-Hoffmann
2019-08-21 Cramer, Kay
Technologie zur ortsnahen und energieeffizienten Suspensionsherstellung unter Verwendung von Stützkorn zum dauerhaften Bergversatz (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2019-08-13 Almasri, Radwan
Energieeffizienz und erneuerbare Energien in der golfregion (online verfügbar)
Betreuer: Prof. Dr. Markus Richter
2019-07-19 Dettmann, André
Eignung autostereoskopischer Displays im Fahrzeugkontext unter Einbeziehung von Ergonomie und Wahrnehmungsleistung
Betreuer: Prof. Dr. Angelika Bullinger-Hoffmann
2019-07-15 Büttner, Rebekka
Entwicklung eines Modells zur Steigerung der Wandlungsfähigkeit produzierender Unternehmen vor dem Hintergrund der Digitalisierung am Beispiel des Automobilbaus
Betreuer: Prof. Dr. Egon Müller
2019-07-01 Wieczorek, geb.Schubach, Katrin
Die Entwicklung eines Verfahrens zur Rekonstruktion informationstechnologie-getriebener Veränderungsprozesse in Unternehmen mittels Aufbereitung heterogener Datenquellen, am Beispiel von ERP-Implementationen in KMU
Betreuer: Prof. Dr. Egon Müller
2019-06-28 Hahn, Thomas
Optimierung der Rekuperationsfähigkeit elektrifizierter Fahrzeugantriebe
Betreuer: Prof. Dr. Thomas von Unwerth
2019-06-18 Bali, Chadha
Coffee-ring-effect based self-assembly mechanism for the realization of all-inkjet printed organic field effect transistors with micron-sized channel length (online verfügbar)
Betreuer: Prof. Dr. Arved Hübler
2019-06-14 Pavlicek, Florentina
Parametrierbare Metamodelle zur Berechnung des Wärmeübergangs in Hohlräumen (online verfügbar)
Betreuer: Prof. Dr. Reimund Neugebauer
2019-05-28 Stoldt, Johannes
Gestaltungsmethodik für Simulationsstudien in Umplanungsprojekten zur Energieeffizienzsteigerung in Fabriken (online verfügbar)
Betreuer: Prof. Dr. Matthias Putz
2019-05-28 Mwangi, James Wamai
Analysis and Optimization of Electrical Discharge machining of Nitinol Shape Memory Alloys
Betreuer: Prof. Dr. Andreas Schubert
2019-05-24 Weisbach, Tobias
Versagensanalyse und Lebensdauerevaluation von kurvengängigen Kunststoffketten (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2019-05-24 Weißgerber, Marco
Bestimmung der spezifischen, oberflächenbedingten Scanning-Antastabweichungen für taktile 3D-Koordinatenmessgeräte (online verfügbar)
Betreuer: Prof. Dr. Sophie Gröger
2019-05-08 Herfert, Heike
Untersuchungen zum Wärme- und Feuchtetransportmanagement von Abstandsgewirken für Bettwaren (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2019-04-26 Leistner, Bastian
Fahrwerksentwicklung und produktionstechnische Integration ab der frühen Produktentstehungsphase
Betreuer: Prof. Mayer
2019-04-18 Zhao (m), Pengcheng
Development and investigation of bio-based environmentally freindly fire retardant PLA composites (online verfügbar)
Betreuer: Prof. Dr. Michael Gehde
2019-04-02 Hirsch, Michael
Analyse der systematischen Geometrieabweichung beim Profilquerwalzen von Schneckenprofilen
Betreuer: Prof. Dr. Birgit Awiszus
2019-03-13 Ballmann, Markus
Hochtemperaturfähiges Übertragungselement für elastische Wellenkupplungen (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2019-03-12 Sayouf , Mohamad Anis
Simulation thermischer Kurzzeit-Multi-Speichersysteme (online verfügbar)
Betreuer: Prof. Dr. Bernd Platzer
2019-03-01 Nguyen Dang, Tan
Entwicklung eines effizienten Montageplanungssystems auf Basis von Funktionsfolgen (online verfügbar)
Betreuer: Prof. Dr. Maik Berger
2019-02-22 Vogel, Veronika
Endlosfaserverstärkte Thermoplaste zur Abschirmung elektromagnetischer Strahlung (online verfügbar)
Betreuer: Prof. Dr. Michael Gehde
2019-02-06 Schmidt, Elisabeth
Wirkung von thermischer Stimulation während passiver Fahrermüdigkeit
Betreuer: Prof. Dr. Angelika Bullinger-Hoffmann
2019-02-04 Pfeiffer, Steffen
Mikromechanische Modellbildung und FE-Simulationen zur elastischen Anisotropie von verzwillingten NiTi-Martensiten
Betreuer: Prof. Dr. Martin Wagner
2019-01-14 Pierschel, Norbert
Werkzeugtechnik und Prozess zur Herstellung pressgehärteter Bauteile mit kleinflächig gradierten Eigenschaften
Betreuer: Prof. Dr. Dirk Landgrebe
2018-12-11 Roth, Tobias
Ermittlung von Kennwerten von einfachwirkenden Umformmaschinen für die zustandsorientierte Instandhaltung und die Qualifizierung des Werkzeugentstehungsprozesses
Betreuer: Prof. Dr. Reimund Neugebauer
2018-12-06 Al-Mashhadani, Hayder Ibrahim Saleh
Refractory metals low temperature dissufion bonding (online verfügbar)
Betreuer: Prof. Dr. Peter Mayr
2018-11-23 Kielhorn, Christoph
Zustandsorientierte Instandhaltung auf Energiedatenbasis in der Automobilproduktion
Betreuer: Prof. Dr. Egon Müller
2018-11-22 Nitsche, Alexander
Metallurgische Erstarrungs-Phänomene bei warmfesten 9%Cr-Schweißzusatzwerkstoffen und deren Auswirkungen auf die Schweißguteigenschaften
Betreuer: Prof. Dr. Peter Mayr
2018-11-14 Grätzl, Thomas Lorenz
Einfluss der automobilen Lackierprozesse auf thermoplastische Strukturbauteile mit Endlosfaserverstärkung
Betreuer: Prof. Dr. Lothar Kroll
2018-11-12 Bauer, Ruben
Modellbasierte Auslegung von Mehrschnittstrategien beim Wälzschälen
Betreuer: Prof. Dr. Reimund Neugebauer
2018-11-02 Heuer, Georg
Development of an operation strategy for electrified auxiliaries on the power train of conventional vehicles (online verfügbar)
Betreuer: Prof. Dr. Thomas von Unwerth
2018-10-22 El-Araby Megahed Ali, Ibrahim
Oxidationsverhalten von Wärmedammschichtsystemen mit Al-Zwischenschichten (online verfügbar)
Betreuer: Prof. Dr. Thomas Lampke
2018-10-12 Scheffler, Thomas
Werkstoffeinflüsse auf den Spritzgussprozess bei Phenol-Formaldehydharz-Formmassen (online verfügbar)
Betreuer: Prof. Dr. Michael Gehde
2018-10-12 Wagensoner, Matthias
Automatisierte Bewertung von Blistern zur Optimierung der Gesamtprozesskette Aluminium-Strukturbauteile (online verfügbar)
Betreuer: Prof. Dr. Sophie Gröger
2018-10-01 Heinrich, Stefan
Modulbasierte Synthese ebener Koppelgetriebe unter Einbeziehung kinetischer Kenngrößen (online verfügbar)
Betreuer: Prof. Dr. Maik Berger
2018-09-26 Buhl, Marcus
Analyse von Strömungseffekten in Schichtenladersystemen (online verfügbar)
Betreuer: Prof. Dr. Bernd Platzer
2018-09-11 Schönherr, Julia
Methode zur techno-energetischen Bilanzierung von Fertigungsprozessketten am Beispiel Presshärten
Betreuer: Prof. Dr. Reimund Neugebauer
2018-09-05 Schmitt, Carsten
Beitrag zur Prädiktion von Schalltransferpfaden in Fahrzeuggetrieben (online verfügbar)
Betreuer: Prof. Dr. Welf-Guntram Drossel
2018-09-03 Pagel, Kenny
Entwicklung von Formgedächtnisaktoren mit Inhärenter Führungsfunktion
Betreuer: Prof. Dr. Welf-Guntram Drossel
2018-09-03 Müller, Peter
Analyse elastischer Wechselwirkungen an Servo-Spindelpressen
Betreuer: Prof. Dr. Welf-Guntram Drossel
2018-08-28 Opitz, Tobias
Vermeidungsstrategien fluiddynamischer Effekte beim Einsatz von Schnellerwärmungstechnologien in der Warmumformung (online verfügbar)
Betreuer: Prof. Dr. Welf-Guntram Drossel
2018-08-23 Börner, Kerstin
Die Altersabhängigkeit der Beanspruchung von Montagemitarbeitern - eine Feldstudie in der Automobilindustrie
Betreuer: Prof. Dr. Angelika Bullinger-Hoffmann
2018-08-13 Kyosev, Yordan
Topologiebasierte Modellierung von Textilstrukturen und deren Produkte - Prinzipien, Algorithmen und Grenzen
Betreuer: Prof. Dr. Holger Cebulla
2018-08-09 Seung, Taehun
Holistic-Light-Weight Approach for actuation systems of the next generation aircraft (online verfügbar)
Betreuer: Prof. Dr. Lothar Kroll
2018-08-09 Goldberg, Niels
Homogenisierung und Modellierung des Materialverhaltens kurzfaserverstärkter Thermoplaste (online verfügbar)
Betreuer: Prof. Dr. Jörn Ihlemann
2018-08-07 Al-Obaidi, Amar Baker Salim
Induktionsgestützte Inkrementelle Blechumformung von hochfesten Stahlwerkstoffen (online verfügbar)
Betreuer: Prof. Dr. Dirk Landgrebe
2018-07-31 Hofbauer, Daniel
Multikriterielle Entscheidungsanalyse und Bauweisenvergleich von Faserverbundtechnologien für die Herstellung von Leichtbau-Karosseriestrukturen
Betreuer: Prof. Dr. Lothar Kroll
2018-07-24 John, Björn
Verwendung instationärer Gasströme in der Lasertechnik (online verfügbar)
Betreuer: Prof. Dr. Peter Mayr
2018-07-10 Regel, Joachim
Bewertung konstruktiver und kompensatorischer Maßnahmen zur thermo-sensitiven Auslegung von Werkzeugmaschinenstrukturen
Betreuer: Prof. Dr. Reimund Neugebauer
2018-07-03 Streb, Fabian
Novel materials for heat dissipation in semiconductor technologies (online verfügbar)
Betreuer: Prof. Dr. Thomas Lampke
2018-06-29 Heinrich, Michael
In-situ-Prozesse zur Kontaktierung und Verbindung piezokeramischer Module neuer Generation
Betreuer: Prof. Dr. Lothar Kroll
2018-06-21 Keller, Carsten
Verfahren zur automatisierten Shim-Maß-Berechnung am Beispiel von Karosseriebauspannvorrichtungen
Betreuer: Prof. Dr. Matthias Putz
2018-06-20 Parodi, Jaime Alejandro Puentes
Adhesion of Polyurethane-Steel Hybrids and Influence of Annealing on its Durability and Lifetime (online verfügbar)
Betreuer: Prof. Dr. Michael Gehde
2018-05-04 Maenz, Torsten
Spritzgießtechnische Herstellung duroplastgebundener Dauermagnete (online verfügbar)
Betreuer: Prof. Dr. Michael Gehde
2018-04-19 Regensburger, Jochen
Nichtlineares Deformationsverhalten von Karosserie-Außenhautbauteilen aus Aluminium im Lacktrocknungsprozess (online verfügbar)
Betreuer: Prof. Dr. Welf-Guntram Drossel
2018-04-16 Meichsner, Gunnar
Entwicklung und Realisierung einer Methode zur Bestimmung von Prozesseingangsgrößen für das elektrochemische Präzisionsabtragen
Betreuer: Prof. Dr. Andreas Schubert
2018-04-13 Strobel, Jens
Untersuchung von Schwingungen an einem Stetigfördersystem mit Kunststoffgleitketten (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2018-03-28 Findeisen, Fabian
Radiale Diffusoren in Warmwasserspeichern - Einfluss des Beladesystems auf Strömungsverhalten und Schichtungsqualität (online verfügbar)
Betreuer: Prof. Dr. Bernd Platzer
2018-03-27 Uhlig, Thomas
Neuartige Co-Basislote zum Hochtemperaturlöten thermisch stark belasteter Bauteile (online verfügbar)
Betreuer: Prof. Dr. Guntram Wagner
2018-03-16 Tästensen, Robert
Integrierte Methode zur objektiven Bewertung von Equipmentfehlern in der Instandhaltung und rationellen Investitionsplanung (SEAFIP)
Betreuer: Prof. Dr. Egon Müller
2018-02-23 Winkler, Ruben
Haftmechanismen von Metallen (Cu, Al) appliziert durch Draht-Lichtbogenspritzen auf Polymeroberflächen (PEEK) (online verfügbar)
Betreuer: Prof. Dr. Thomas Lampke
2018-02-23 Hartung, Ingmar
Fahrzeugnahe Methoden zur Diagnose von Degradationsvorgängen an automobilen PEM-Brennstoffzellen-Aggregaten (online verfügbar)
Betreuer: Prof. Dr. Thomas von Unwerth
2018-02-20 Elibol, Cagatay
Lokalisierungs- und Relaxationsphänomene in pseudoelastischen und martensitischen NiTi-Formgedächtnislegierungen
Betreuer: Prof. Wagner
2018-02-12 Simon, Katharina
Erfassung des subjektiven Erlebens jünger und älterer Autofahrer zur Ableitung von Unterstützungsbedürfnissen im Fahralltag
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2018-01-24 Siebeck, Steve
Pulvermetallurgische Synthese von Aluminiummatrix-Verbundwerkstoffen durch Hochenergiemahlen
Betreuer: Prof. Dr. Guntram Wagner
2018-01-22 Qin, Renhang
Dynamische Simulation des Verhaltens von Gasen in Heizungsanlagen (online verfügbar)
Betreuer: Prof. Dr. Bernd Platzer
2018-01-19 Weiß, Frederik
Methodik zur optimalen Konzeptauslegung elektrifizierter Fahrzeugantriebe
Betreuer: Prof. Dr. Thomas von Unwerth
2017-12-20 Wächter, Michael
Engineering-Methode zur Gestaltung gebrauchstauglicher tangibler Mensch-Maschine-Schnittstellen für Planer und Entwickler von Produktionsassistenzsystemen
Betreuer: Prof. Dr. Angelika Bullinger-Hoffmann
2017-12-18 Kaiser, André
Modellierung maximaler menschlicher Muskelmomente auf Basis digitaler Menschmodelle - am Beispiel der oberen Extremitäten
Betreuer: Prof. Dr. Angelika Bullinger-Hoffmann
2017-11-21 Kleicke, Roland
Analyse und Optimierung der Webtechnik zur Realisierung von textilen Halbzeugen mit gestreckten Fadenlagen für die Faserverbundwerkstoffe (online verfügbar)
Betreuer: Prof. Dr. Holger Cebulla
2017-11-16 Winter, Sven
Mikrostrukturelle Einflussparameter auf die adiabatische Scherbandbildung in einer metastabilen ?-Titanlegierung
Betreuer: Prof. Wagner
2017-11-13 Steinert, Philipp
Fertigung und Bewertung deterministischer Oberflächenmikrostrukturen zur Beeinflussung des tribologischen Verhaltens von Stahl-Bronze-Gleitpaarungen
Betreuer: Prof. Dr. Andreas Schubert
2017-11-02 Härtel, Markus
Werkstoffmechanischer und mikrostruktureller Vergleich von uniaxialen und biaxialen Bauschinger-Effekten im Blechwerkstoff DC06im Blechwerkstoff DC06
Betreuer: Prof. Dr. Martin Wagner
2017-10-20 Rosen, Philipp
Beitrag zur thermischen und geometrischen Optimierung von Wasserstoffdruckbehältern für die automobile Anwendung
Betreuer: Prof. Dr. Thomas von Unwerth
2017-10-12 Bräunig, Jan
Entwicklung und Verifizierung eines Berechnungsmodells zur Anregungsprognose von Verzahnungen unter Berücksichtigung des anisotropen Materialverhaltens
Betreuer: Prof. Dr. Reimund Neugebauer
2017-10-10 Dietz, Ronald
Strukturbezogene Betrachtung zum Zeitstandverhalten geschweißter Polyolefinhalbzeuge - Morphologie und Bruchverhalten (online verfügbar)
Betreuer: Prof. Dr. Michael Gehde
2017-09-19 Dallinger, Niels
Die Diskrete Elemente Methode in der Vibrationsfördertechnik (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2017-09-18 Putzke, Enrico
Charakteristik und Verhalten von synthetischen Faserstoffen in homogenen und heterogenen Wirkpaarungen (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2017-09-12 Bartsch, Ralf
Erweiterung der Dimensionierungsgrundlagen für Gleitkettensysteme (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2017-09-11 Drehmann, Rico
Haftmechanismen kaltgasgespritzter Aluminiumschichten auf keramischen Oberflächen (online verfügbar)
Betreuer: Prof. Dr. Thomas Lampke
2017-09-08 Donner, Hendrik
FEM-basierte Modellierung von Hybridcorden und Hybridcord-Elastomer-Verbunden (online verfügbar)
Betreuer: Prof. Dr. Jörn Ihlemann
2017-09-05 Irmscher, Susann
Neues Programmmodell für das Pulsschweißen (online verfügbar)
Betreuer: Prof. Dr. Klaus-Jürgen Matthes
2017-08-24 Todt, Andreas
Beitrag zur Entwicklung neuartiger hybrider Werkstoffverbunde auf Keramik/Polymer-Basis (online verfügbar)
Betreuer: Prof. Dr. Guntram Wagner
2017-08-09 Weil, Christoph
Technologische Wirkzusammenhänge des kontinuierlichen Widerstands-Pressschweißens mit umschließendem Induktor
Betreuer: Prof. Dr. Dirk Landgrebe
2017-08-07 Zillmann, Benjamin
Fließspannungsermittlung an Feinblechen unter ebener biaxialer Druckbelastung
Betreuer: Prof. Dr. Thomas Lampke
2017-07-20 Hielscher, Holger
Entwicklung einer Hochleistungsultraschalleinheit mit hohen Schwingungsamplituden (online verfügbar)
Betreuer: Prof. Dr. Reimund Neugebauer
2017-07-20 Hecht, Benjamin
Vorhersage und Bewertung der Qualitätskriterien rollgefalzter Karosserieanbauteile
Betreuer: Prof. Dr. Reimund Neugebauer
2017-07-17 Hoffmann, Uwe
Kennzahlenbasierte Entscheidungsunterstützung für die aggregierte Produktionsprogrammplanung
Betreuer: Prof. Dr. Egon Müller
2017-06-22 Quade, Michael
Methodik zur Entwicklung eines Baukastens für wandlungsfähige Produktionsmittel
Betreuer: Prof. Dr. Egon Müller
2017-06-12 Raschke, Kristin
Grundlagenuntersuchungen zur Prozess- und Struktursimulation von Phenolharzformmassen mit Kurz- und Langglasfaserverstärkung (online verfügbar)
Betreuer: Prof. Dr. Michael Gehde
2017-06-09 Sowade, Enrico
Selbstorganisationsphänomene nanoskopischer Materialien im Inkjetdruck (online verfügbar)
Betreuer: Prof. Dr. Reinhard R. Baumann
2017-06-08 Michna, Gregor
Planungsmodell für die montagegerechte Produktbeeinflussung in der Produktentstehungsphase eines Automobilherstellers
Betreuer: Prof. Dr. Egon Müller
2017-06-07 Kaars, Jonny
Zur Thermomechanik des Widerstandspunktschweißens von Vergütungsstahl am Blechstoß mit Spalt (online verfügbar)
Betreuer: Prof. Dr. Peter Mayr
2017-05-19 Hoppe, Thomas
Thermodynamische Analyse von Konzepten zur Energierückgewinnung aus Wasserstoffspeichern für PEM-Brennstoffzellensysteme (online verfügbar)
Betreuer: Prof. Dr. Thomas von Unwerth
2017-05-11 Mehner, Thomas
Zusammenhänge zwischen Werkstoff- und Oberflächenzustand und der Korrosionsanfälligkeit von Metallen (online verfügbar)
Betreuer: Prof. Dr. Thomas Lampke
2017-05-05 Küchler, Pierre
Fahrzeugnahe Kühlungsrandbedingungen von Abgassystemen an Motorprüfständen
Betreuer: Prof. Dr. Bernd Platzer
2017-05-05 Konarsky, Michael
Entwicklung eines IT-gestützten Kosteninformations-Systems als Instrument des Produktkostenmanagements in der Auftragsfertigung
Betreuer: Prof. Dr. Erhard Leidich
2017-04-28 Arnold, Roman
Entwicklung eines Modells zur Bewertung der Qualität der Digitalen Fabrik am Beispiel der Automobilindustrie
Betreuer: Prof. Dr. Egon Müller
2017-04-21 Sacher, Patrick
Rückfederungsreduzierung durch simulationsbasierte Methodenoptimierung in der Blechumformung (online verfügbar)
Betreuer: Prof. Dr. Birgit Awiszus
2017-03-31 Meyer, Daniel
Korrelation zwischen Herstellungsprozess, Struktur und Eigenschaften von anodischen Aluminiumoxidschichten für Verschleißschutzanwendungen (online verfügbar)
Betreuer: Prof. Dr. Thomas Lampke
2017-02-23 Hipp, Kevin
Einsatz hybrider Optimierungsverfahren zur Inbetriebnahme elektromechanischer Systeme
Betreuer: Prof. Dr. Reimund Neugebauer
2017-02-20 Schulze, Karola
Adhäsions- und Degradationsverhalten an der Grenzfläche zwischen Titan und Polyetheretherketon (online verfügbar)
Betreuer: Prof. Dr. Bernhard Wielage
2017-02-14 Ulke-Winter, Lars
Naturanaloge Optimierungsverfahren zur Auslegung von Faserverbundstrukturen (online verfügbar)
Betreuer: Prof. Dr. Lothar Kroll
2017-02-13 Krones, Manuela
A Method to Identify Energy Efficient Measures for Factory Systems Based on Qualitative Modeling
Betreuer: Prof. Dr. Egon Müller
2017-01-26 Podlesak, Frank
Entwicklung und Verifizierung eines vorlochfreien mechanischen Fügeverfahrens zum Verbinden von Leichtmetallen und Faser-Kunststoff-Verbunden (online verfügbar)
Betreuer: Prof. Dr. Peter Mayr
2017-01-18 Fritsch, Sebastian
Einfluss von Tieftemperaturumformungen auf das Werkstoffverhalten einer hochfesten AlZnMgCu-Legierung
Betreuer: Prof. Dr. Martin Wagner
2017-01-10 Jäckel, Mathias
Erweiterung der Prozessgrenzen für das Halbhohlstanznieten durch den Einsatz geteilter Matrizenwerkzeuge
Betreuer: Prof. Dr. Dirk Landgrebe
2016-12-21 Krauß, Alexander
Optimierte Sickengestaltung im Konstruktionsprozess dünnwandiger Bauteile (online verfügbar)
Betreuer: Prof. Dr. Erhard Leidich
2016-12-21 Sieber, Maximilian
Elektrochemisches Modell zur Beschreibung der Konversion von Aluminium durch anodische Oxidation (online verfügbar)
Betreuer: Prof. Dr. Thomas Lampke
2016-12-19 Krüger, David
Auslegungsgrenzen, Grübchen- und Zahnfußtragfähigkeit asymmetrischer Stirnradverzahnungen
Betreuer: Prof. Dr. Erhard Leidich
2016-12-16 Rautenstrauch, Anja
Methodik zur Prozessauslegung anforderungsgerecht gestalteter Strukturbauteile im Automobilbau
Betreuer: Prof. Dr. Reimund Neugebauer
2016-12-06 Vibrans, Tobias
Induktive Erwärmung von Formplatinen für die Warmumformung (online verfügbar)
Betreuer: Prof. Dr. Welf-Guntram Drossel
2016-11-11 Danzer, Christoph
Systematische Synthese, Variation, Simulation und Bewertung von Mehrgang- und Mehrantrieb-Systemen rein elektrischer und hybrider Fahrzeugantriebe
Betreuer: Prof. Dr. Thomas von Unwerth
2016-11-10 Gelbrich, Sandra
Funktionsintegrative Leichtbaustrukturen für Tragwerke im Bauwesen (online verfügbar)
Betreuer: Prof. Dr. Lothar Kroll
2016-11-02 Naumann, Christoph
Chemisch-mechanisch gekoppelte Modellierung und Simulation oxidativer Alterungsvorgänge in Gummibauteilen (online verfügbar)
Betreuer: Prof. Dr. Jörn Ihlemann
2016-10-26 Özdeniz, Eyüp Akin
Entwicklung korrosions- und verschleißbeständiger thermisch gespritzter Zylinderlaufbahnen für Verbrennungsmotoren (online verfügbar)
Betreuer: Prof. Dr. Thomas Lampke
2016-10-21 Siengchin, Suchart
Naturfaserverstärkte Thermoplaste (Natural Fiber Reinforced Thermplastics) (online verfügbar)
Betreuer: Prof. Dr. Lothar Kroll
2016-10-07 Kalinowska, Agnieszka
Wissenschaftlich-technischer Beitrag zum prozessintegrierten Bedrucken von Kunststoffteilen während des Spritzgießens
Betreuer: Prof. Dr. Michael Gehde
2016-09-28 Sadeghi, Amir
Microstructure evolution and strengthening mechanism in Ni-based composite coatings (online verfügbar)
Betreuer: Prof. Dr. Thomas Lampke
2016-08-30 Alaluss, Khaled Ahmed
Modellbildung - Simulation des Plasma-Schweißens zur Entwicklung innovativer Schweißbrenner (online verfügbar)
Betreuer: Prof. Dr. Klaus-Jürgen Matthes
2016-08-19 Hofmann, Stefan
Untersuchungen zur Ermüdungsfestigkeit von Pressverbindungen (online verfügbar)
Betreuer: Prof. Dr. Erhard Leidich
2016-08-18 Gerstmann, Thoralf
Erweiterung der Verfahrensgrenzen desn Flach-Clinchens (online verfügbar)
Betreuer: Prof. Dr. Birgit Awiszus
2016-08-02 Kretschmer, Andreas
Einflussfaktoren auf die Lebensdauer laufender Faserseile
Betreuer: Prof. Dr. Klaus Nendel
2016-07-12 Pflugradt, Noah
Modellierung von Wasser- und energieverbräuchen in Haushalten (online verfügbar)
Betreuer: Prof. Dr. Bernd Platzer
2016-07-01 Müller, Sascha
Kerbfestigkeitsanalyse nietgefügter Faserverbund- und Metallkomponenten unter Berücksichtigung richtungsabhängiger lokaler Versagensmechansimen
Betreuer: Prof. Dr. Lothar Kroll
2016-07-01 Hammerschmidt, Jens
Inkjet-based manufacture and mechanical reinforsement of microsieves (Inkjekt-basierte Herstellung und mechanische Stabilisierung von Mikrosieben) (online verfügbar)
Betreuer: Prof. Dr. Reinhard R. Baumann
2016-06-27 Schlutter, Ruben
Ermittlung von Korrekturfaktoren zur Verbesserung der Qualität des Druckes von Spritzgießsimulationen
Betreuer: Prof. Dr. Michael Gehde
2016-05-20 Maaß, geb. Leck, Lena
Strategische Einbindung der Umformsimulation in die Entwicklungsprozesskette Karosserie (online verfügbar)
Betreuer: Prof. Dr. Birgit Awiszus
2016-05-20 Wulf, Hans
Modellierung und Simulation von Selbstorganisationsprozessen in belasteten technischen Gummiwerkstoffen (online verfügbar)
Betreuer: Prof. Dr. Jörn Ihlemann
2016-05-02 Lamprecht, Andreas
Energieprädiktion und Reichweitendarstellung durch Navigationsdaten im Kraftfahrzeug (online verfügbar)
Betreuer: Prof. Mayer
2016-04-29 Vidner, Jakub
Methode zur Bewertung der Ermüdungsfestigkeit von reibdauerbeanspruchten Systemen
Betreuer: Prof. Dr. Erhard Leidich
2016-04-22 Bleesen, Christoph
Neue Verfahrenstechnologien und funktionelle Oberflächen zur gezielten Manipulation der tribologischen Eigenschaften von Bauteilen aus Kunststoffen (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2016-04-08 Klauke, Rainer
Lebensdauervorhersage mehrachsig belasteter Elastomerbauteile unter besonderer Berücksichtigung rotierender Beanspruchungsrichtungen (online verfügbar)
Betreuer: Prof. Dr. Jörn Ihlemann
2016-04-01 Nestler, Matthias
Umformung metallbasierter Mehrschichtverbunde mit Sensor- und Aktorfunktionalität
Betreuer: Prof. Dr. Reimund Neugebauer
2016-03-31 Hensel, Sebastian
Numerisch-simulative Modellbildung für die Entwicklung von Technolgien zur Herstellung von Piezo-Metall-Verbunden und deren Charakterisierung
Betreuer: Prof. Dr. Reimund Neugebauer
2016-03-31 Rehm, Matthias
Analyse mechanisch gekoppelter, gegenläufig verfahrender Direktantriebe und ihre Einordnung mittels prozessorientierter Entwicklungsmethodik
Betreuer: Prof. Dr. Reimund Neugebauer
2016-03-04 Denninger, Daniel
Prozessorientierte Synthesemethodik am Beispiel der neuartigen Verlegetechnik D-3F zum Überflechten mit drei Fadensystmen (online verfügbar)
Betreuer: Prof. Dr. Maik Berger
2016-02-12 Holl, Kai
Beitrag zum Laserdurchstrahlschweißen von Kunststoffen in der Medizintechnik
Betreuer: Prof. Dr. Michael Gehde
2016-01-29 Roder, Kristina
Matrix- und Interfacedesign bei faserverstärkter Keramik auf Basis des Flüssigsilicierverfahrens (online verfügbar)
Betreuer: Prof. Dr. Bernhard Wielage
2016-01-15 Plorin, Daniel
Gestaltung und Evaluation eines Referenzmodells zur Realisierung von Lernfabriken im Objektbereich der Fabrikplanung und des Fabrikbetriebes
Betreuer: Prof. Dr. Egon Müller
2015-12-16 Barthel, Tom
Prozessanalyse und effektive Gestaltung von Hochgeschwindigkeitsscherschneidproessen
Betreuer: Prof. Dr. Reimund Neugebauer
2015-12-16 Zillger, Tino
Ortsaufgelöste Untersuchung massengedruckter Polymersolarzellen auf flexiblem Substrat (online verfügbar)
Betreuer: Prof. Dr. Arved Hübler
2015-12-16 Müller, Michael
Direktmontage von Pierzokeramik-Bauelementen in mikrostrukturierte Bleche
Betreuer: Prof. Dr. Reimund Neugebauer
2015-12-04 Reißmann, Jan
Beitrag zur Entwicklung einer verbesserten Berechnungsmethode für die Ermittlung der Zahnfußtragfähigkeit von Zylinderschneckengetrieben (online verfügbar)
Betreuer: Prof. Dr. Erhard Leidich
2015-11-23 Siegel, Frank
Tiefdruckverfahren zur Herstellung von Katalysatorschichten für (PEM) Brennstoffzellen (online verfügbar)
Betreuer: Prof. Dr. Reinhard R. Baumann
2015-11-20 Hausner, Susann
Potential von Nanosuspensionen zum Fügen bei niedrigen Temperaturen (online verfügbar)
Betreuer: Prof. Dr. Bernhard Wielage
2015-11-20 König, Johannes
Auslegung eines optimierten Lichtbogendrahtspitzprozesses für Zylinderlaufbahnen von Verbrennungsmotoren
Betreuer: Prof. Dr. Bernhard Wielage
2015-11-20 Lätzer, Michael
Untersuchungen zum Füge- und Übertragungsverhalten torsionsbelasteter Stahl-Aluminium-Rändelpressverbindungen (online verfügbar)
Betreuer: Prof. Dr. Erhard Leidich
2015-11-06 Schellenberg, Dirk
Identifikation und Optimierung im Kontext technischer Anwendungen
Betreuer: Prof. Dr. Jörn Ihlemann
2015-11-02 Israel, Markus
Sensitivitäts- und Robustheitsanalyse beim Clinchen dicker Stahlbleche
Betreuer: Prof. Dr. Reimund Neugebauer
2015-10-30 Walther, Mario
Entwicklung und Evaluierung eines systematischen Vorgehens zur Erfassung von Aktionskräften in der Automobilproduktion (online verfügbar)
Betreuer: Prof. Dr. Angelika Bullinger-Hoffmann
2015-10-20 Landgraf, Ralf
Modellierung und Simulation der Aushärtung polymerer Werkstoffe (online verfügbar)
Betreuer: Prof. Dr. Jörn Ihlemann
2015-10-19 Schneebauer, Martin
Neue Kunststofftechnologien zur Herstellung hybrider Leichtbaustrukturen mit hoher Funktionsdichte
Betreuer: Prof. Dr. Lothar Kroll
2015-10-07 Müller, Christoph
Untersuchung von Holzwerkstoffen unter Schlagbelastung zur Beurteilung der Werkstoffeignung für den Maschinenbau (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2015-10-05 Elgert, Thomas
Entwicklung eines Vorgehensmodells zur Unterstützung der Implementierung betrieblicher Informationssysteme in der Automobilproduktion – unter besonderer Berücksichtigung der Arbeits- und Prozessorganisation
Betreuer: Prof. Dr. Egon Müller
2015-09-30 Oppelt, Thomas
Modell zur Auslegung und Betriebsoptimierung von Nah- und Fernkältenetzen (online verfügbar)
Betreuer: Prof. Dr. Bernd Platzer
2015-09-28 Moch, Robert
Methodik zur Auswahl und zum Einsatz von Koordinationsinstrumenten in Produktionsnetzen
Betreuer: Prof. Dr. Egon Müller
2015-09-04 Huang, Weilin
Beitrag zum Kerbspannungsverhalten anisotrop verstärkter Mehrschichtverbunde unter Berücksichtigung hygrothermischer Einflüsse
Betreuer: Prof. Dr. Lothar Kroll
2015-08-19 Schulze, Robin
Methodik zur integrativen Funktionsbestimmung und Dimensionierung von Maschinen und Transportmitteln
Betreuer: Prof. Dr. Egon Müller
2015-07-28 Fischer, Marko
Leitfaden für Anlaufmanagement im Automobilbau unter Berücksichtigung von Standortbestimmungen
Betreuer: Prof. Dr. Egon Müller
2015-07-23 Englich, Sascha
Strukturbildung bei der Verarbeitung von glasfasergefüllten Phenolformaldehydformmassen (online verfügbar)
Betreuer: Prof. Dr. Michael Gehde
2015-06-29 Trnovec, Bystrik
Experimentelle Untersuchungen zur Schichtbildung im Tiefdruck mittels hydrophobierter Druckform mit Applikationsbeispielen aus dem Bereich der gedruckten OPV (online verfügbar)
Betreuer: Prof. Dr. Arved Hübler
2015-06-24 Asdonk, Matthias
Modell zur Darstellung der Schlüsselelemente und Mechanismen eines Führungssystems Shop Floor
Betreuer: Prof. Dr. Egon Müller
2015-06-23 Hopf, Hendrik
Methodik zur Fabriksystemmodellierung im Kontext von Energie- und Ressourceneffizienz
Betreuer: Prof. Dr. Egon Müller
2015-04-15 Langer, Tino
Ermittlung der Produktivität verketteter Produktionssysteme unter Nutzung erweiterter Produktdaten
Betreuer: Prof. Dr. Reimund Neugebauer
2015-04-15 Schützle, Wilhelm
Beitrag zur Prozesskettensimulation geschweißter Aluminium-Karosserieanbauteile
Betreuer: Prof. Dr. Reimund Neugebauer
2015-04-09 Dittrich, Frank
Instrumentarium zur Unterstützung der nutzerzentrierten Entwicklung in kleinen und mittleren Unternehmen am Beispiel betrieblicher Anwendungssoftware
Betreuer: Prof. Dr. Angelika Bullinger-Hoffmann
2015-03-27 Ebert, Falk
Serielle Modellierung ebener Band- und Koppelgetriebe zur domänenübergreifenden Gesamtsimulation von nichtlinearen Antriebssystemen (online verfügbar)
Betreuer: Prof. Dr. Maik Berger
2015-03-16 Heine, Andreas
Ein Beitrag zur kennwertorientierten Entwicklung von kurvengesteuerter, ebener Schrittgetriebe (online verfügbar)
Betreuer: Prof. Dr. Maik Berger
2015-02-26 Schwanitz, Stefan
Mechanische Simulation der Interaktion Sportler-Sportgerät (online verfügbar)
Betreuer: Prof. Dr. Stephan Odenwald
2015-02-19 Zinecker, Mike
Einsatz mikro- und mesostrukturierter Oberflächen zur Verbesserung des Wärmeübergangs bei der Siedekühlung
Betreuer: Prof. Dr. Andreas Schubert
2015-01-27 Jentsch, David
Wandlungsfähigkeit im Management produzierender Unternehmen
Betreuer: Prof. Dr. Egon Müller
2015-01-08 Mammitzsch, Jens
Untersuchungen zum Einsatz von ultrahochmolekularen Polyethylenfasern in Seilen für die Fördertechnik (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2014-12-12 Emmrich, Jens
Ein Beitrag zum technologischen Konzept, zur Funktion und Berechnung hybrider Filterzyklone für die Partikelabscheidung aus Gasen (online verfügbar)
Betreuer: Prof. Dr. Günter Wozniak
2014-12-11 Frint, Philipp
Lokalisierungsphänomene nach kombinierter hochgradig plastischer Umformung durch Extrusion und ECAP einer 6000er-Aluminiumlegierung
Betreuer: Prof. Dr. Thomas Lampke
2014-12-05 Liu, Yao
Heat transfer process between polymer and cavity wall during injection molding (online verfügbar)
Betreuer: Prof. Dr. Michael Gehde
2014-12-04 Hoyer, Stefan
Neuartige Warmmahltechnologie zum Recycling von Elastomeren und Analyse prozessbedingter Eigenschaften
Betreuer: Prof. Dr. Lothar Kroll
2014-11-07 Eben, Johannes
Identifikation und Reduzierung realer Schwankungen durch praxistaugliche Prozessführungsmethoden beim Spritzgießen (online verfügbar)
Betreuer: Prof. Dr. Michael Gehde
2014-11-04 Imgrund, Christian
Ganzheitliche Ansätze und Methoden zur nachhaltigen Nauplanung einer energieeffizienten Fabrik mit besonderem Schwerpunkt auf die Automobilmontage (online verfügbar)
Betreuer: Prof. Dr. Bernd Platzer
2014-11-03 Oehme, Daniel
Bausteinbasiertes Modell zur Integration von Projektplanung, Projektbearbeitung und Projektabschluss für Fabrikplanungsprojekte
Betreuer: Prof. Dr. Egon Müller
2014-10-24 Hellmich, Arvid Sören
Nichtinvasive Identifikation von Regelstreckenparametern für elektromechanische Achsen
Betreuer: Prof. Dr. Reimund Neugebauer
2014-10-24 Glänzel, Janine
Korrektur thermoplastischer Verformungen durch den Einsatz der adaptiven FEM
Betreuer: Prof. Dr. Reimund Neugebauer
2014-10-23 Höer, Martin
Einfluss der Material- und Verarbeitungseigenschaften von Phenolharzformmassen auf die Qualität spritzgegossener Bauteile (online verfügbar)
Betreuer: Prof. Dr. Michael Gehde
2014-10-17 Sommer, Oliver
Ein Beitrag zur Untersuchung des Verhaltens dünner Flüssigkeitsfilme nahe gekrümmten Substratoberflächen - Exp. Beschichtungsversuche und numerische Filmsimulation (online verfügbar)
Betreuer: Prof. Dr. Günter Wozniak
2014-10-06 Bankwitz, Hagen
Simulation und Analyse ringgespannter Zahnriemengetriebe (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2014-09-25 Merklinger, Verena
Beitrag zur Entwicklung einer niedrigschmelzenden Legierung und deren Applikation zum Korrosionsschutz hochfester Stahlsorten
Betreuer: Prof. Dr. Bernhard Wielage
2014-09-24 Weise, Sebastian
Entwicklung und Evaluation von Hochleistungsgleitketten aus Kunststoff
Betreuer: Prof. Dr. Klaus Nendel
2014-09-19 Grönke, Kerstin
Beitrag zur Optimierung der Verfahrensparameter von Vliesstoffausrüstungsprozessen bei hohen Warengeschwindigkeiten (online verfügbar)
Betreuer: Prof. Dr. Bernd Platzer
2014-08-22 Zwingenberger, Carsten
Beitrag zur Verbesserung der Simulationsgenauigkeit bei der Bestimmung des thermischen Verhaltens von Werkzeugmaschinen
Betreuer: Prof. Dr. Reimund Neugebauer
2014-08-04 Wonneberger, Kai-Uwe
Konzept zur Zielplanung für die Fabrikplanung mit unternehmenswertorientierter Ausrichtung
Betreuer: Prof. Dr. Egon Müller
2014-07-03 Mäder, Thomas
Neuartige Sensoren zur Erfassung von Dehnungen in Faserverbundwerkstoffen (Structural Health Monitoring) (online verfügbar)
Betreuer: Prof. Dr. Bernhard Wielage
2014-06-26 Friedrich, Sven
Lineares Vibrationsschweißen von Kunststoffen im industriellen Umfeld - Einflüsse und Restriktionen (online verfügbar)
Betreuer: Prof. Dr. Michael Gehde
2014-06-23 Münnich, Mario
Strategische multikriterielle Standort- und Fabrikplanungsmethodik mittels szenariendifferenzierter und risikobasierter Produktrechnungen
Betreuer: Prof. Dr. Egon Müller
2014-06-19 Kaufmann, Jörg
Beitrag zu anisotropiebedingten Koppeleffekten bei rotationssymmetrischen mehrschichtigen Faserverbundbauteilen
Betreuer: Prof. Dr. Lothar Kroll
2014-05-23 Feuerhack, Andreas
Experimentelle und numerische Untersuchungen von Al-Mg-Verbunden mittels Verbundschmieden (online verfügbar)
Betreuer: Prof. Dr. Birgit Awiszus
2014-05-09 Shutov, Alexey
Numerische Simulation des viskoplastischen Verhaltens metallischer Werkstoffe bei endlichen Deformationen14.11.2012 (online verfügbar)
Betreuer: Prof. Dr. Jörn Ihlemann
2014-04-04 Jentsch, Martin
Eignung von objektiven und subjektiven Daten im Fahrsimulator am Beispiel der aktiven Gefahrenbremsung – eine vergleichende Untersuchung (online verfügbar)
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2014-03-17 Hälsig, Andrè
Energetische Bilanzierung von Schutzgasschweißverfahren (online verfügbar)
Betreuer: Prof. Dr. Peter Mayr
2014-03-10 Georgi, Wolf
Beitrag zum mechanischen Fügen von Metall-Kunststoff-Mischverbindungen (online verfügbar)
Betreuer: Prof. Dr. Klaus-Jürgen Matthes
2014-03-04 Kotik, Florian Max
Integration von Fertigungswissen in den digitalen Planungsprozess der Automobilindustrie
Betreuer: Prof. Dr. Egon Müller
2014-03-04 Scherf, Christian
Entwicklung, Herstellung und Evaluation des Modularen Alterssimulationsanzugs eXtra(MAX) (online verfügbar)
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2014-02-27 Rutsch, Andreas
Methodik zur Gestaltung von Lagersystemen in globalen Distributionsnetzwerken für Multibranchenprodukte dargestellt am Beispiel der DKHS Holding, Schweiz
Betreuer: Prof. Dr. Egon Müller
2014-02-10 Chen , Xiaoli
Beitrag zur Bewertung technologischer Innovationsfähigkeit sowie zur Entscheidungsunterstützung für Unternehmen in Innovationsnetzwerken
Betreuer: Prof. Dr. Egon Müller
2014-02-05 Ebbinghaus, Michael
Untersuchung der Verarbeitungseigenschaften im MIG-und Laserlötprozess an Stahlblechen mit unterschiedlichem Festigkeitsverhalten (online verfügbar)
Betreuer: Prof. Dr. Klaus-Jürgen Matthes
2014-01-30 Schönherr, geb. Jendrusch, Ricardo
Simulationsbasierte Absicherung der Ergonomie mit Hilfe digital beschriebener menschlicher Bewegungen (online verfügbar)
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2014-01-29 Kleditzsch, Stefan
Beitrag zur Modellierung und Simulation von Zylinderdrückwalzprozessen mit elementaren Methoden (online verfügbar)
Betreuer: Prof. Dr. Birgit Awiszus
2014-01-24 Gansauge, Ludwig-Ingo
Methodik zur Industrialisierung der Einzelfertigung am Beispiel des Werkzeug- und Formenbaus
Betreuer: Prof. Dr. Egon Müller
2014-01-14 Pinner, Sebastian
Untersuchung von Methoden zur durchgängigen Prozesskettensimulation im Karosseriebau
Betreuer: Prof. Dr. Birgit Awiszus
2013-12-18 Kick, Marco
Gebremste Laufwagensysteme für Schwerkrafthängeförderer im Rahmen einer nachhaltigen Low-Cost-Fördertechnik
Betreuer: Prof. Dr. Klaus Nendel
2013-12-09 Jakubik, Uwe
Effizienzermittlung von Maßnahmen mit Gwichtsauswirkung in der PkW-Entwicklung (online verfügbar)
Betreuer: Prof. Dr. Erhard Leidich
2013-12-02 Drechsler, Florian
Modulares Behältersystem für die Automobilindustrie, deren Zulieferer und Logistikdienstleister
Betreuer: Prof. Dr. Klaus Nendel
2013-11-13 Özer, Ihsan Ulas
Legierungstechnische und tribologische Entwicklung von Bremsscheiben aus Aluminium-Matrixkompositen
Betreuer: Prof. Dr. Thomas Lampke
2013-11-08 Truckenbrodt, Christian
Beitrag zur Entwicklung und Integration unterschiedlicher Methoden zur Online-Qualitätssicherung beim Laserstrahlschweißen von Aluminiumkehlnähten
Betreuer: Prof. Dr. Reimund Neugebauer
2013-11-06 Maurer, Thomas
Zur kosteneffizienten Herstellung von gewickelten Faserverbundwalzen unter Berücksichtigung der Methode der Lean Production (online verfügbar)
Betreuer: Prof. Dr. Lothar Kroll
2013-11-04 Nestler, Daisy
Beitrag zum Thema: Verbundwerkstoffe - Werkstoffverbunde - Status quo und Forschungsansätze (online verfügbar)
Betreuer: Prof. Dr. Bernhard Wielage
2013-10-16 Teich, Tobias
Geschäftsprozessgetriebene Konfiguration wandlungsfähiger Gebäudeinfrastrukturen
Betreuer: Prof. Dr. Egon Müller
2013-09-23 Lauterbach, Johannes Michael
Energie ScoreCard - Bewertungskriterien für Kraftwerke und ihre Relevanz aus Investorensicht
Betreuer: Prof. Dr. Bernd Platzer
2013-09-04 Zhang , Ran
Spanen thermoplastischer Kunststoffe mit vielschneidigen geometrischen nicht bestimmten Schneiden (Schleifen und Polieren)
Betreuer: Prof. Dr. Andreas Schubert
2013-08-16 Heinze, Thorsten
Zug- und biegewechselbeanspruchte Seilgeflechte aus hochfesten Polymerfasern
Betreuer: Prof. Dr. Klaus Nendel
2013-08-14 Krebs, Janine
Zum Einfluss der Werkzeugoberfläche auf die Entformbarkeit und die Oberflächenqualität von Spritzgießbauteilen
Betreuer: Prof. Dr. Lothar Kroll
2013-07-30 Gröger, Sophie
Funktionsgerechte Spezifikation geometrischer Eigenschaften mit dem System der Geometrischen Produktspezifikation und -verifikation (online verfügbar)
Betreuer: Prof. Dr. Michael Dietzsch
2013-07-22 Vay, Henrik
Vorgehensmodell zum Projekt-Risikomanagement im Anlagenbau
Betreuer: Prof. Dr. Egon Müller
2013-07-11 Maiwald, Andreas
Numerische Analyse des Wanderverhaltens von Wälzlagerringen
Betreuer: Prof. Dr. Erhard Leidich
2013-06-21 Bergmann, Markus
Verfahren zur Herstellung gradiert hochgradig plastisch umgeformter Werkstoffe
Betreuer: Prof. Dr. Reimund Neugebauer
2013-06-21 Dix, Martin
Ressourceneffizientes Hochleistungsbohren mit Spiralbohrern - Analyse und Prozessauslegung
Betreuer: Prof. Dr. Reimund Neugebauer
2013-06-19 Hübler, Jörg
Textilverstärkte Zugmittel für die Antriebs- und Fördertechnik mit formschlüssiger Krafteinleitung (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2013-06-04 Brückner, Karoline
Charakterisierung der mechanischen Eigenschaften von weichelastischen Schaumstoffen unter impulsartigen sportspezifischen Belastungen (online verfügbar)
Betreuer: Prof. Dr. Stephan Odenwald
2013-05-29 Weigelt, Karin
Integration gedruckter Elektronik in Kunststoffe durch Folienhinterspritzen (online verfügbar)
Betreuer: Prof. Dr. Arved Hübler
2013-05-08 Clauß, Michael
Methode zum Einsatz von Web 2.0-Werkzeugen in der Fabrikplanung (online verfügbar)
Betreuer: Prof. Dr. Egon Müller
2013-05-03 Klimant, Philipp
Virtual Reality gestützte Kinematik- und Materialabtragssimulation für Fräsmaschinen mittels Hardware-in-the-Loop
Betreuer: Prof. Dr. Reimund Neugebauer
2013-05-03 Kräusel , Verena
Gestaltung und Bewertung einhubiger Scherschneidverfahren mit starren Werkzeugen unter besonderer Berücksichtigung der Schnittflächenqualität an Blechbauteilen
Betreuer: Prof. Dr. Reimund Neugebauer
2013-05-02 Bester, Alwyn
Entwicklung von alternativen Erwärmungsmethoden für Mangan-Bor-Stähle
Betreuer: Prof. Dr. Reimund Neugebauer
2013-04-11 Schönherr, Micaela
Entwicklung und Implementierung produktbezogener Dienstleistungen in der Werkzeugmaschinenindustrie
Betreuer: Prof. Dr. Reimund Neugebauer
2013-03-26 Dombeck, Uwe
Beitrag zur Dimensionierung von Fördersystemen mit Staurollenketten (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2013-03-15 Winkler, Sebastian
Generierung von Teilarbeitsgängen im Rahmen eines durchgängigen Ansatzes zur automatischen Arbeitsplanerstellung
Betreuer: Prof. Dr. Egon Müller
2013-03-04 Philipp, Klaus
Kosteneffiziente Leichtbaustrukturen für denPkw-Innenraum mit hochwertigen funktionellen Oberflächen
Betreuer: Prof. Dr. Lothar Kroll
2013-02-28 Härtig, Thomas
Stoffübertragung beim Spritzgießen (online verfügbar)
Betreuer: Prof. Dr. Michael Gehde
2013-02-20 Helbig, geb. Speck, Markus
Methoden zur Bestimmung der Ablegereife an hochfesten Kunstfaserseilen
Betreuer: Prof. Dr. Klaus Nendel
2013-02-20 Seidlitz, Holger
Entwicklung von kraftflussgerechten Verbindungstechniken für Mischbauweisen mit thermoplastischen Faserverbunden und Metallen
Betreuer: Prof. Dr. Lothar Kroll
2013-02-20 Löser, Carsten
Präzises Schneiden schwer zu bearbeitender Materialien durch Wasserabrasivinjektorstrahlen mit verringertem Strahldurchmesser
Betreuer: Prof. Dr. Holger Dürr
2013-02-15 Freund, Michael
Verallgemeinerung eindimensionaler Materialmodelle für die Finite-Elemente-Methode
Betreuer: Prof. Dr. Jörn Ihlemann
2013-02-07 Härtel, Sebastian
Experimentelle und numerische Untersuchungen zur Verfahrensentwicklung des Unrunddrückens (online verfügbar)
Betreuer: Prof. Dr. Birgit Awiszus
2013-01-28 Li , Lei
Synergetische Planungsmethodik für Industrieparks
Betreuer: Prof. Dr. Egon Müller
2013-01-25 Fuhrich, René
Infrarotschweißen von Kunststoffen mit thermischen Strahlungsemittern
Betreuer: Prof. Dr. Michael Gehde
2013-01-24 Heuß, Hans-Peter
Qualifikation als Innovationsfaktor am Beispiel der externen Promotion
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2013-01-15 Ponton, Philipp Manuel
Methodik zur Abwicklung von Produktionsverlagerungen
Betreuer: Prof. Dr. Egon Müller
2013-01-09 Rohrmus, Dominik
Adaptive invariante Merkmale für die Texturklassifikation
Betreuer: Prof. Dr. Birgit Awiszus
2013-01-08 Waltl, Hubert
Selbstoptimierung der Einarbeit von Karosseriewerkzeugen durch werkzeugintegrierte Aktorik
Betreuer: Prof. Dr. Reimund Neugebauer
2012-12-20 Buschmann, Markus
Planung und Betrieb von Energiedatenerfassungssystemen
Betreuer: Prof. Dr. Egon Müller
2012-12-19 Eichhorn, Sven
Berechnungsansatz für Strukturbauteile aus Holzfurnierlagenverbundwerkstoff-WVC (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2012-12-19 Eckardt, Ronny
Untersuchungen an Verbindungselementen für Holzkonstruktionen im Maschinen- und Anlagenbau (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2012-12-13 Jung, geb.Steger, Heike
Neuartige dispersionsverstärkte Kontaktwerkstoffe auf Silber-Basis
Betreuer: Prof. Dr. Bernhard Wielage
2012-12-03 Kausch, Martin
Entwicklung hochbelasteter Leichtbaustrukturen aus lasergenerierten metallischen Komponenten mit Faserverbundverstärkung
Betreuer: Prof. Dr. Lothar Kroll
2012-11-29 Leesch, Mirko
Beitrag zur systematischen Synthese und Bewertung von Doppelkupplungsgetrieben
Betreuer: Prof. Dr. Peter Tenberge
2012-11-29 Rupprecht , Christian
Moderne Methoden und Anwendungen des Thermischen Spritzens (online verfügbar)
Betreuer: Prof. Dr. Bernhard Wielage
2012-11-29 Nickel , Daniela
Ausgewählte Eigenschaften und Charakterisierungsmethoden von biodegradierbaren und archäologischen metallbasierten Werkstoffen
Betreuer: Prof. Dr. Thomas Lampke
2012-11-16 Krauß, Andreas
Zustandsgeregelte dynamische Dimensionierung von Produktionssystemen im Kontext des Produktionsmanagements (online verfügbar)
Betreuer: Prof. Dr. Egon Müller
2012-11-02 Riedel, Ralph
Systemische Fabrikplanung auf Basis eines kybernetisch-soziotechnischen Modells
Betreuer: Prof. Dr. Egon Müller
2012-11-01 Scholz, Sebastian
Epoxidharzbasierte Nanokomposit-Schichten für mechanisch, tribologisch und medial belastete Faser-Kunststoff-Verbunde
Betreuer: Prof. Dr. Lothar Kroll
2012-10-26 Hermann, Jörn
Kennzahlbasierte Planungsmethode zur Optimierung der Anlagennutzung von Großteilpressen
Betreuer: Prof. Dr. Reimund Neugebauer
2012-10-19 Herrle, Tobias
Entwicklung und Erprobung eines Online-Lackmischverfahrens für die Automobilserienlackierung
Betreuer: Prof. Dr. Günter Wozniak
2012-10-05 Richter, Markus
Virtual Reality-unterstützte Optimierung des dynamischen Verhaltens von Werkzeugmaschinen
Betreuer: Prof. Dr. Reimund Neugebauer
2012-10-04 Kuprin, geb. Gahlert, Corinna
Verformungsverfestigung bei zyklisch inkrementeller Torsion von Reineisen und dem Stahl 42CrMo4N (online verfügbar)
Betreuer: Prof. Wagner
2012-09-26 Mainda, Patrick Michael
Piezoelektrische Aktoren in Presswerkzeugen zur Beeinflussung des Umformprozesses
Betreuer: Prof. Dr. Reimund Neugebauer
2012-09-25 Hofmann, Stefan
Identifikation parametrischer Modelle für geregelte, elektromechanische Achsen mit modifizierter sukzessiver Polkompensationan mechatronischen Achsen
Betreuer: Prof. Dr. Reimund Neugebauer
2012-09-05 Tröltzsch, Jürgen
Spritzgießtechnische Direktimprägnierung textiler Halbzeuge und Preformen bei komplexen Hochleistungsbauteilen
Betreuer: Prof. Dr. Lothar Kroll
2012-08-24 Ihlenfeldt, Steffen
Redundante Werkzeugmaschinenstruktur für die Komplettbearbeitung im Großwerkzeugbau - Modellbasierter Systementwurf und Prototyp
Betreuer: Prof. Dr. Reimund Neugebauer
2012-07-30 Neukirchner, Heiko
Wirkungsgrade und dynamisches Verhalten von Ventilsteuerungen mit pneumatischer Ventilfeder
Betreuer: Prof. Dr. Peter Tenberge
2012-07-30 Endres, Martin
Entwicklung einer aktiven Steuerung für die geometrischen Qualitätsziele der Prozesskette Karosseriebau
Betreuer: Prof. Dr. Michael Dietzsch
2012-07-18 Rasch, Frank
Reibungsminderung an Stütz- und Führungselementen für Kunststoffketten
Betreuer: Prof. Dr. Klaus Nendel
2012-07-12 Darwich , Samer
Corrosion protection concepts for aluminium and magnesium alloys coated with silicate films prepared by water-based-sol-gel process (online verfügbar)
Betreuer: Prof. Dr. Thomas Lampke
2012-06-29 Petersen, Udo
Beitrag zum Übertragungsverhalten von rechteckförmigen Mehrschraubenverbindungen (MV)
Betreuer: Prof. Dr. Erhard Leidich
2012-06-29 Lehmann, Thomas
Experimentell-numerische Analyse mechanischer Eigenschaften von Aluminium/Magnesium-Werkstoffverbunden
Betreuer: Prof. Dr. Jörn Ihlemann / Dr. Stockmann
2012-06-28 Jander, Henning
Entwicklung einer Methode zur produktbasierten Reduzierung der Zeitspreizung in der Automobilmontage
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2012-06-22 Kolouch, Martin
Simulation des Einflusses der Gelenke auf das statische und dynamische Verhalten von parallelkinematischen Werkzeugmaschinen
Betreuer: Prof. Dr. Reimund Neugebauer
2012-06-20 Wetzel, Tommy
Magnesiumblech-Technologiekette für innovative Leichtbauanwendungen im Automobilbau
Betreuer: Prof. Dr. Reimund Neugebauer
2012-06-12 Kranz, Burkhard
Beitrag zur numerischen Beschreibung des funktionellen Verhaltens von Piezoverbundmodulen (online verfügbar)
Betreuer: Prof. Dr. Reimund Neugebauer
2012-05-31 Eckert, Alexander
Prognose der Maßhaltigkeit punktförmig mechanisch gefügter Karosseriebauteile
Betreuer: Prof. Dr. Reimund Neugebauer
2012-05-22 Reuter, Kay
Elektrostatische Aufladung von organischen Feldeffekttransistoren zur Verbesserung einfacher gedruckter Schaltungen
Betreuer: Prof. Dr. Arved Hübler
2012-05-16 Dreves, Frank
Empirische Studie von Werkmechanismen zum Wandel in der Arbeitswelt am Beispiel Ergonomie, Demographie und Führung
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2012-05-11 Kittner, Kai
Integrativer Modellansatz bei der Co-Extrusion von Aluminium-Magnesium-Verbunden (online verfügbar)
Betreuer: Prof. Dr. Birgit Awiszus
2012-04-20 Deckert, Matthias H.
Beitrag zur Entwicklung eines hochdynamischen variothermen Temperiersystems für Spritzgießwerkzeuge (online verfügbar)
Betreuer: Prof. Dr. Lothar Kroll
2012-03-27 Badra, Hashem
Entwicklung eines Navigators für die Fertigungssimulation
Betreuer: Prof. Dr. Egon Müller
2012-03-20 Weis, Sebastian
Beitrag zur Entwicklung partikelverstärkter Weich- und Weichaktivlote zum Fügen temperaturempfindlicher Aluminiummatrix-Verbundwerkstoffe (online verfügbar)
Betreuer: Prof. Dr. Bernhard Wielage
2012-03-16 Stocek, Radek
Zur dynamischen Rissausbreitung von Elastomerwerkstoffen (online verfügbar)
Betreuer: Prof. Dr. Michael Gehde
2012-03-07 Mühlstedt, Jens
Entwicklung eines Modells dynamisch-muskulärer Arbeitsbeanspruchungen auf Basis digitaler Menschmodelle (online verfügbar)
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2012-02-09 Zeidler, Henning
Schwingungsunterstützte Mikro-Funkenerosion
Betreuer: Prof. Dr. Andreas Schubert
2012-02-08 Billig, Susan
Abbau von Polyethylenterephthalat mit PET-Hydrolasen aus Thermobifida fusca KW3 (online verfügbar)
Betreuer: Prof. Dr. Bernd Platzer / Prof. Zimmermann
2012-02-08 Müller, Jörg
Beitrag zur systematischen, rechnergestützten Synthese und Bewertung mehrgängiger konventioneller und hybrider Planetenautomatikgetriebe
Betreuer: Prof. Dr. Peter Tenberge
2012-01-31 Tran , Ngoc Anh
Featurebasierte Entscheidungsmethodik zur Bewertung alternativer technologischer Prozessketten in der Teilefertigung
Betreuer: Prof. Dr. Holger Dürr
2012-01-23 Beyer, Ulrike
Multi-Flach-Fügen mittels Flach-Clinch-Technologie
Betreuer: Prof. Dr. Birgit Awiszus
2011-12-22 Rinberg, Roman
Technologieentwicklung zur Herstellung von naturfaserverstärkten Bauteilen in Leichtbauweise unter Einsatz von Ganzpflanzenrohstoffen
Betreuer: Prof. Dr. Lothar Kroll
2011-12-16 Jahn, Stephan Felix
Möglichkeiten und Herausforderungen des Funktionsdrucks mittels Inkjettechnologie, gezeigt an zwer Anwendungsbeispielen
Betreuer: Prof. Dr. Reinhard R. Baumann
2011-12-15 Kienzle, Florian
Fertigungssteuerung in der Musterfertigung von Systemlieferanten (online verfügbar)
Betreuer: Prof. Dr. Egon Müller
2011-12-14 Schob, Uwe
Methode zur frühen virtuellen Inbetriebnahme von Steuerungsprogrammen durch halbautomatische Maschinenmodellbildung
Betreuer: Prof. Dr. Reimund Neugebauer
2011-11-22 Glühmann, Jan
Verschleißmechanismen und Leistungspotenziale stickstoffgesinterter Gradientenhartmetalle für die Zerspanung
Betreuer: Prof. Dr. Holger Dürr
2011-11-21 Hubrig, Marko
Methode zur integrativen kostenorientierten Produktionssystemplanung im Kontext der digitalen Fabrik
Betreuer: Prof. Dr. Egon Müller
2011-11-15 Urbaneck, Thorsten
Kältespeicher - Grundlagen, Technik, Anwendung
Betreuer: Prof. Dr. Bernd Platzer
2011-10-17 Schmidt, Georg
Oberflächenspannungstrukturiertes Drucken zur Herstellung polymerelektronischer Bauteile
Betreuer: Prof. Dr. Arved Hübler
2011-09-30 Sittiho, Mutchima
Qualitative Beurteilung des Gaseintrages in thermische Energieversorgungssysteme auf Grund der Gaspermeation (online verfügbar)
Betreuer: Prof. Dr. Bernd Platzer
2011-09-21 Bartzsch, Matthias
Herstellung von Schottky-Dioden mittels Rolle-zu-Rolle-Verfahren
Betreuer: Prof. Dr. Arved Hübler
2011-08-30 Hensel-Unger, Ralph
Entwicklung einer Gestaltungssystematik für das Industrial Engineering unter besonderer Berücksichtigung kultureller Einflussfaktoren am Beispiel von Tschechien und Polen
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2011-08-26 Keil, Mathias
Entwicklung eines arbeitswissenschaftlichen Modellansatzes für die nachhaltige Implementierung von Produktionssystemen in Unternehmen
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2011-07-29 Chodora, Marco
SALUCONTROL - Nutzen-Aufwand-Kalkulation von Maßnahmen im betrieblichen Gesundheitsmanagement mit Support des Controllings
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2011-07-29 Enderlein, Heiko
Flexible Analyse- und Bewertungs-Systematik zur Gestaltung nachhaltig effektiver, effizienter und menschgerechter Arbeit in indirekten Bereichen am Beispiel eines Automobilherstellers
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2011-07-26 Hockauf, Kristin
Ermüdungs- und Rissfortschrittsverhalten ausscheidungshärtbarer ultrafeinkörniger Aluminimlegierungen (online verfügbar)
Betreuer: Prof. Dr. Thomas Lampke
2011-07-22 Kern, Colin
Untersuchung des Betriebsverhaltens von Mehrflächengleitlagern mit Kunststofflaufschicht
Betreuer: Prof. Dr. Erhard Leidich
2011-05-20 Meißner, Christian
Entwicklung von Getriebesystemen zur aktiven Drehmomentenverteilung für Fahrzeuganwendungen
Betreuer: Prof. Dr. Peter Tenberge
2011-04-08 Steinbach, Hendrik
Verfahren zur thermischen und mechanischen Auslegung von zyklisch arbeitenden Radialstromapparaten
Betreuer: Prof. Dr. Bernd Platzer
2011-03-14 Michael, Markus
Beitrag zur Treibfähigkeit von hochfesten synthetischen Faserseilen (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2011-03-14 Angermann, Kay
Beitrag zur Entwicklung und Fertigung einer lokalen und beanspruchungsrechten Verstärkung für hochfeste Aluminiumbauteile
Betreuer: Prof. Dr. Bernhard Wielage
2011-03-03 Schneider, Thomas
Automatisierte Akquisition von erfahrungsbasiertem Fertigungswissen im Werkzeug- und Formenbau
Betreuer: Prof. Dr. Holger Dürr
2011-02-17 Ebert, Lars
Beeinflussung von geschweißten Auftragschichten durch instationäre Gasströme im Plasma-Pulver-Schweißprozess (online verfügbar)
Betreuer: Prof. Dr. Klaus-Jürgen Matthes
2011-01-28 Hädrich, Katrin
Ermittlungen und Untersuchungen zum Stirnfräsen typischer duro- und thermoplastischer Kunststoffe
Betreuer: Prof. Dr. Holger Dürr
2010-12-17 Mejia Ambriz, Alejandro
Produktinnovation durch Kompetenzclusterbildung in kompetenzzellenbasierten Netzen (online verfügbar)
Betreuer: Prof. Dr. Reimund Neugebauer
2010-12-16 Mayer, Michael
Modellierung des statischen und dynamischen Materialverhaltens langfaserverstärkter Kunststoffe
Betreuer: Prof. Meyer
2010-12-14 Kuhl, Michael
Beitrag zur Qualitätsbewertung von Laserschweißnähten im Karosseriebau durch multivariate Datenanalyse von Sensorsignalen aus Pre-, In- und Postprozessmessverfahren
Betreuer: Prof. Dr. Reimund Neugebauer
2010-11-26 Kim , Young Eun
Modified Phenol-Formaldehyde Resins for C-Fiber Reinforces Composites: Chemical Characteristics of Resind, Microstructure and Mechanical Properties of their Composites (online verfügbar)
Betreuer: Prof. Dr. Bernhard Wielage
2010-11-12 Lomachenko, Olga
Beiträge zum Einsatz solar unterstützter Systeme zur Beheizung von Industriegebäuden im Bestand
Betreuer: Prof. Dr. Bernd Platzer
2010-11-02 Faust, Karsten
Neue polymere Werkstoffkonzepte für Fördergleitketten und Systemanalyse der Korrelation von Reibungskoeffizienten
Betreuer: Prof. Dr. Klaus Nendel
2010-11-01 Leiber, Paul
Ergonomische Produktgestaltung am Beispiel mobiler Geräte im interkulturellen Vergleich: China-Deutschland-USA (online verfügbar)
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2010-10-26 King Kordi, Amal
Methodik zur bausteinbasierten Planung und Organisation von verfahrenstechnischen Produktionssystemen
Betreuer: Prof. Dr. Egon Müller
2010-10-21 Merz, Ludger
New dynamic approach of a Safety Barrier Wall for a Civil Transport Aircraft
Betreuer: Prof. Dr. Reiner Kreißig
2010-10-13 Weigert, Philipp
Berücksichtigung formänderungsbedingter Effekte (Rückfederung) im Entwicklungsprozess der Methodenplanung von tiefgezogenen Karosseriebauteilen
Betreuer: Prof. Dr. Reimund Neugebauer
2010-09-10 Hegner, Claus
Modellbasierte Vernetzung strategischer und operativer Anlaufgrößen von interdependenten Fahrzeugprojekten
Betreuer: Prof. Dr. Egon Müller
2010-09-08 Nachtwey, Alexander
Methodischer Beitrag zur Betriebsanalyse komplexer Produktionssysteme
Betreuer: Prof. Dr. Egon Müller
2010-06-17 Sritragool , Kunlapaporn
Modification of rubber particle filled thermoplastics with electrons during polymer processing or after molding
Betreuer: Prof. Dr. Michael Gehde
2010-06-04 Baumgart, Rico
Reduzierung des Kraftstoffverbrauches durch Optimierung von Pkw-Klimaanlagen
Betreuer: Prof. Dr. Peter Tenberge
2010-06-03 Simon, Marc
Entwicklung eines ganzheitlichen globalen Projektmanagement Systems unter besonderer Berücksichtigung interkultureller Unterschiede
Betreuer: Prof. Dr. Egon Müller
2010-04-20 Lindner, Mario
Ermittlung der plastischen Anfangsanisotropie durch Eindringversuche (online verfügbar)
Betreuer: Prof. Dr. Reiner Kreißig
2010-03-31 Grund, Thomas
Applikation, Charakterisierung und Einsatz kaltgasgespritzter Kupfer-Nickel-Lotschichten für TiAl 6 V 4-Substrate
Betreuer: Prof. Dr. Bernhard Wielage
2010-03-26 Pursche, Frank
Spezifizierung des Versagensverhaltens von Werkstoffen bei Druck-Scher-Belastung
Betreuer: Prof. Meyer
2010-03-10 Lohse, Rolf
Einfluss von Beladeeinrichtungen auf die thermische Schichtung in Warmwasserspeichern
Betreuer: Prof. Dr. Bernd Platzer
2009-12-15 Wözel, Margit
Grundlegende Untersuchungen zum Verhalten von Verschleißschutzschichten bei Beanspruchung auf Ermüdungsverschleiß
Betreuer: Prof. Dr. Bernhard Wielage
2009-12-14 Hartmann, Uwe
Erhöhung der Verschleißfestigkeit von aktiven Werkzeugelementen und von Gleitringdichtsystemen im elastomerverarbeitenden Maschinenbau durch Einsatz alternativer Werkstoffe und Technologien
Betreuer: Prof. Dr. Bernhard Wielage
2009-11-25 Hackert, Matthias
Entwicklung und Simulation eines Verfahrens zum elektrochemischen Abtragen von Mikrogeometrien mit geschlossenem elektrolytischen Freistrahl
Betreuer: Prof. Dr. Andreas Schubert
2009-11-19 Ecorchard, Gael
Static Accuracy Enhancement of Redundantly Actuated Parallel Kinematic Machine Tools (online verfügbar)
Betreuer: Prof. Dr. Reimund Neugebauer
2009-10-15 Winkler, Anders
Experimentelle und theoretische Untersuchungen zur kunststoffgerechten Auslegung von Zahnrädern
Betreuer: Prof. Dr. Erhard Leidich
2009-08-06 Fiebig, Siegfried
Wandel zur flexiblen Fabrik - Konsequenzen für die Steuer- und Fördertechnik
Betreuer: Prof. Dr. Klaus Nendel
2009-07-10 Hockauf, Matthias
Fließspannungsverhalten ultrafeinkörniger Aluminiumwerkstoffe unter besonderer Berücksichtigung der Dehnrate
Betreuer: Prof. Meyer
2009-07-07 Khaddour , Mounib
Negativbaufbau im Rollenoffsetdruck (online verfügbar)
Betreuer: Prof. Beier
2009-06-10 Böttcher, Sebastian
Beitrag zur Planung stückzahlflexibler Fertigungssysteme
Betreuer: Prof. Dr. Egon Müller
2009-05-26 Nickel, Daniela
Gefüge- und Eigenschaftscharakterisierungen unbeschichteter grobkörniger und ultrafeinkörniger sowie anodisch oxidierter Aluminiumlegierungen
Betreuer: Prof. Dr. Bernhard Wielage
2009-05-15 Nebel, Silvio
Ein Beitrag zur experimentellen und numerischen Analyse zeitabhängiger Eigenschaften von DMS-Messstellen
Betreuer: Prof. Dr. Naumann
2009-05-08 Mischke, Michael
Multimodale Bedienkonzepte im Dualtask - ein Ansatz für komplexe Bedienaufgaben im Fahrzeug
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2009-04-29 Ebert, Andreas
Berücksichtigung der elastischen Werkzeugdeformation im Bereich der Massivumformung am Beispiel Gesenkschmieden
Betreuer: Prof. Dr. Birgit Awiszus
2009-04-17 Wießner, Sven
Kontinuierliche Herstellung von Legierungen aus Elastomerpartikeln und Polypropylen durch reaktive Aufbereitung in einem Gleichdralldoppelschneckenextruder (online verfügbar)
Betreuer: Prof. Dr. Günter Mennig
2009-04-14 Lehmann, Maik
Entwicklung einer Methodik zur Gestaltung von handlungsleitenden Informationsprozessen in Fertigungsabläufen der variantenreichen Großserienfertigung
Betreuer: Prof. Dr. Egon Müller
2009-03-27 Opitz, Andreas
Methodik zur Planung ganzheitlich prozesseffizienter Fertigungssysteme
Betreuer: Prof. Dr. Egon Müller
2009-03-06 Hänel, Thomas
Technologieentwicklung für die Herstellung patientenindividueller Knochenaufbauimplantate aus Beta-Tricalciumphosphat durch 3D-Printing
Betreuer: Prof. Dr. Holger Dürr
2009-03-05 Bahn, Volker
Implementierung der Mehrpunkt-Technologie in den Innenhochdruck-Blechumformprozess (IHB)
Betreuer: Prof. Dr. Reimund Neugebauer
2009-03-02 Rupprecht, Christian
Ganzheitliche Verfahrens- und Schichtoptimierung für das Hochgeschwindigkeitsdrahtflammspritzen (online verfügbar)
Betreuer: Prof. Dr. Bernhard Wielage
2009-02-17 Dietrich, Axel Maximilian
Gestaltung intra-organisationaler Produktionsnetzwerke - Methodik zur Konfiguration und Bewertung unternehmensinterner Produktionsnetzwerke mit standortübergreifender Kooperation zwischen Entwicklung und Produktion
Betreuer: Prof. Dr. Egon Müller
2009-02-11 Schlegel, Gert
Experimentelle Untersuchungen zu Farbfilmbildungsprozessen in Sprühfarbwerken von Offsetdruckmaschinen (online verfügbar)
Betreuer: Prof. Dr. Arved Hübler
2009-02-03 Höinghaus, Lars
Entwicklung einer Simulationsmethodik zur Optimierung des Kühlschmierstoffeinsatzes bei mehrstufigen Warmumformprozessen
Betreuer: Prof. Dr. Birgit Awiszus
2009-01-26 Mokhtar , Mohd Noriznan
Biocatalytic Production, Preparation and Characterization of Large-Ring Cyclodextrins (online verfügbar)
Betreuer: Prof. Dr. Bernd Platzer / Prof. Zimmermann
2009-01-16 Leischnig, Steffen
Entwicklung standardisierter Abläufe zur Verbesserung der Prozesszuverlässigkeit von Fertigungsanlagen (online verfügbar)
Betreuer: Prof. Dr. Egon Müller
2009-01-09 Fischer, Thomas
Erzeugung leitfähiger Strukturen auf benetzungsstrukturierten Polymeroberflächen
Betreuer: Prof. Dr. Arved Hübler
2008-12-15 Heintz, Steffen
Kooperationskultur projektbezogener Unternehmenskooperationen in KMU - Ein Beitrag zur Entwicklung eines Gestaltungsansatzes
Betreuer: Prof. Dr. Egon Müller
2008-12-05 Baum, Heiko
Morphologie der Kooperation als Grundlage für das Konzept der Zwei-Ebenen-Kooperation
Betreuer: Prof. Dr. Egon Müller
2008-12-04 Engelmann, Jörg
Methoden und Werkzeuge zur Planung und Gestaltung energieeffizienter Fabriken
Betreuer: Prof. Dr. Egon Müller
2008-11-06 Werner, André
Thermische Stabilität von abriebfähigen Ddichtungswerkstoffen auf Nickel- oder Kobaltbasis für Hochdruckverdichter
Betreuer: Prof. Dr. Bernhard Wielage
2008-10-23 Schulz, Bertram
Hochgenaue Lagezuordnung von Mikrobauteilen durch greiferintegrierte Winkelfeinstellungen (online verfügbar)
Betreuer: Prof. Dr. Reimund Neugebauer
2008-10-17 Gleich, Sven
Simulation des thermischen Verhaltens spanender Werkzeugmaschinen in der Entwurfsphase
Betreuer: Prof. Dr. Reimund Neugebauer
2008-09-18 Lehmann, Jens
Entwicklung von Methoden für Fabrikplanungsprozesse unter Nutzung von Werkzeugen der Digitalen Fabrik
Betreuer: Prof. Dr. Egon Müller
2008-09-17 Kaiser, Michael
Mehrkriterielle Adaption multimedialer Prozessbeschreibungen für den Fabrikbetrieb mittels wissensbasierter Planungssysteme
Betreuer: Prof. Dr. Egon Müller
2008-09-12 Thurner, Stefan
Erzeugung und Anwendung modulierter Prozessgasströme beim Schutzgasschweißen (online verfügbar)
Betreuer: Prof. Dr. Klaus-Jürgen Matthes
2008-08-29 Herzig, Norman
Beitrag zur Erfassung und Beschreibung des skalierten Fließ.-Verfestigungs- und Versagensverhalten ausgewählter metallischer Werkstoffe in einem weiten Bereich von Dehngeschwindigkeiten und Temperaturen (online verfügbar)
Betreuer: Prof. Meyer
2008-08-27 Binotsch, Carolin
Modellierung und Simulation des KRM- Planetenschrägwalzprozesses
Betreuer: Prof. Dr. Birgit Awiszus
2008-08-14 Mitzschke, Frank
Eigenschaftsprofile neuartiger faserverstärkter Kunststoffgleitketten für den Stückguttransport
Betreuer: Prof. Dr. Klaus Nendel
2008-08-11 Linke, Thomas
Ein Beitrag zur Dimensionierung des Schüttgutaustrages mittels Umschlagrad
Betreuer: Prof. Dr. Klaus Nendel
2008-07-24 Henze, Lars
Entwicklung einer Methode zum Aufdecken von potentiellen Fehlern in der Konstruktion (online verfügbar)
Betreuer: Prof. Dr. Michael Dietzsch
2008-07-17 Gerlach, Marco
Erfassungsstrategie zur Ermittlung des Paarungsmaßes an zylindrischen Oberflächen für die mechanische Antastung (online verfügbar)
Betreuer: Prof. Dr. Michael Dietzsch
2008-07-11 Walther, Volkhard
Grundlagen des Übertragungsverhaltens zentralverschraubter Stirnpressverbindungen
Betreuer: Prof. Dr. Erhard Leidich
2008-06-06 Seifert, Michael
Temperiertes Innenhochdruck-Umformen von Rohren aus Magnesium- und Aluminiumlegierungen (online verfügbar)
Betreuer: Prof. Dr. Reimund Neugebauer
2008-06-05 Kaden, Hendrik
Beitrag zum Reibungs- und Verschleißverhalten von Zahnriemenförderern (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2008-06-03 Cho , Sang Hyun
Auswirkung von Nichtidealitäten auf den Ablauf von Folgereaktionen in Rohrraktoren (online verfügbar)
Betreuer: Prof. Dr. Bernd Platzer
2008-05-26 Schütze, Jens
Grundlagen und Ansätze zur Modellierung von Kommunikationsprozessen in KMU-Netzwerken
Betreuer: Prof. Dr. Egon Müller
2008-05-26 Mücklich , Silke
Leichtbaupotenziale durch Einsatz von Leichtmetallen Fachgebiet: Werkstofftechnik (online verfügbar)
Betreuer: Prof. Dr. Bernhard Wielage
2008-05-26 Lampke , Thomas
Gestaltung techn.Oberflächen mit funktionalen AufgabenFG: Werkstofftechnik und Oberflächentechnik
Betreuer: Prof. Dr. Bernhard Wielage
2008-05-14 Einhaus, Marco
Beitrag zur Verbesserung des Sicherheitsstandards bei seilunterstützten Arbeitsverfahren im internationalen Vergleich
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2008-05-13 Gelbrich, Sandra
Beitrag zur Entwicklung von Krafteinleitungselementen für hochbeanspruchte Faserverbund-Zugstreben im Bauwesen
Betreuer: Prof. Dr. Lothar Kroll
2008-05-07 Horbach, Sebastian
Modulares Planungskonzept für Logistikstrukturen und Produktionsstätten kompetenzzellenbasierter Netze
Betreuer: Prof. Dr. Egon Müller
2008-04-30 Raupach, Annett
Ergonomische Gestaltung multimedialer Arbeitsmittel
Betreuer: Prof. Dr. Birgit Spanner-Ulmer / Prof. Enderlein
2008-03-12 Tran , Thanh Ngoc
Limit and Shakedown Analysis of Plates and Shells Including Uncertainties (online verfügbar)
Betreuer: Prof. Dr. Reiner Kreißig
2008-03-07 Reinstettel, Marc
Laboruntersuchung zur Prozessstabilität beim Niet-Clinchen (online verfügbar)
Betreuer: Prof. Dr. Reimund Neugebauer
2008-02-20 Enge, Holger
Methodische Ansätze zur Verbesserung der Integration des Service in den Produktlebenszyklus von Automobilen
Betreuer: Prof. Dr. Egon Müller
2008-02-19 Reiche, Michael
Referenzmodellierung technologischer Hauptprozesse der grafischen Industrie (online verfügbar)
Betreuer: Prof. Dr. Arved Hübler
2008-02-15 Koca, Matthias
Untersuchungen zur Temperaturabhängigkeit des Formänderungsvermögens unter Beachtung des hydrostatischen Spannungszustandes
Betreuer: Prof. Dr. Naumann
2008-02-14 Gieschen, Katja
Kaizenorientierte Ablauforganisation am Beispiel schlanker Montagesysteme
Betreuer: Prof. Dr. Egon Müller
2008-02-11 Rahm, Jens
Herstellung langfaserverstärkter Aluminium-Matrix-Verbundwerkstoffe durch Anwendung der Prepregtechnik (online verfügbar)
Betreuer: Prof. Dr. Bernhard Wielage
2008-02-07 Stanková, Hana
Einfluss der inkrementellen Deformationen bei der thermomechanischen Behandlung auf die Eigenschaften von TRIP Stählen (online verfügbar)
Betreuer: Prof. Meyer
2007-12-14 Gerber, Anna
Methode zur Konzeption eines unternehmerspezifischen Qualitätsinformationssystems für kleinere Unternehmen (online verfügbar)
Betreuer: Prof. Dr. Michael Dietzsch
2007-12-13 Schumann, Mathias
Zur Bestimmung der Umschlagleistung von Hochregallagern unter besonderer Berücksichtigung der Lagerorganisation (online verfügbar)
Betreuer: Prof. Dr. Klaus Nendel
2007-12-06 Hensel, Sven
Modellierung und Optimierung von Werkzeugmaschinen mit parallelkinematischen Strukturen
Betreuer: Prof. Dr. Reimund Neugebauer
2007-12-03 Krüger, Wilfried
Theoretische und empirische Beiträge zur Fabrikplanung unter dem Aspekt des demografischen Wandels
Betreuer: Prof. Dr. Egon Müller
2007-11-30 Schmiedl, Nadja
Methodik zur prozessorientierten Restrukturierung von Arbeitssystemen
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2007-11-12 Ortmann, Sebastian
Herstellung von Blechdurchzügen (Kragen) in IHU-Bauteilen mit Hilfe von flüssigem Druckmedium
Betreuer: Prof. Dr. Reimund Neugebauer
2007-10-24 Matz, Detlef
Methode der logistischen Werkstruktur-Überplanung für Anlagen zur Herstellung von Fließgütern
Betreuer: Prof. Wirth
2007-09-05 Ackermann, Jörg
Modellierung, Planung und Gestaltung der Logistikstrukturen kompetenzzellenbasierter Netze (online verfügbar)
Betreuer: Prof. Dr. Egon Müller
2007-08-07 Gumpoltsberger, Gerhard
Systematische Synthese und Bewertung von mehrgängigen Planetengetrieben
Betreuer: Prof. Dr. Peter Tenberge
2007-07-25 Schröder, Thomas
Entwicklung und Evaluation von Algorithmen zur zeitoptimierten Bewegungszerlegung bei kinematisch redundanten Werkzeugmaschinen
Betreuer: Prof. Dr. Reimund Neugebauer
2007-07-17 Herold, Katrin
Entwicklung von standardisierten Prozessbausteinen für seilunterstützte Rettungs- und Bergeprozesse (online verfügbar)
Betreuer: Prof. Dr. Birgit Spanner-Ulmer
2007-07-13 Wucherer, Marc
Beitrag zur produktionstechnischen Gestaltung in Niedriglohnländern dargelegt am Fallbeispiel einer Elektronikproduktion in China
Betreuer: Prof. Dr. Egon Müller
2007-07-05 Gröger, Sophie
Beitrag zum ganzheitlichen Bewerten von geometrischen Strukturen mit Tastschnittgeräten bis in den Nanometerbereich (online verfügbar)
Betreuer: Prof. Dr. Michael Dietzsch
2007-06-26 Kondapalli , Satyanarayana
Oberflächenmodifikation von Aluminium-Bauteilen durch Entwicklung von Verbundbeschichtungen mit Hilfe des Plasma-Pulver-Auftragschweißprozesses
Betreuer: Dr.-Ing.habil. F. Riedel
2007-06-15 Wilhelm, Gerald
Quantitative Optimierung des Energieeintrags beim MSG-Hochleistungsschweißen nichtrostender Stähle
Betreuer: Prof. Dr. Klaus-Jürgen Matthes
2007-05-18 Weiß, Jörg
Modellbildung und Simulation radial gekoppelter Rotoren (online verfügbar)
Betreuer: Prof. Dr. Hans Dresig
2007-04-27 Khadjavi (m), Armin Fazlollah
Ein Beitrag zur statischen Aeroelastik des Windkraftanlagenrotorblattes (online verfügbar)
Betreuer: Prof. Dr. Günter Wozniak
2007-04-26 Näser, Peggy
Methode zur Entwicklung und kontinuierlichen Verbesserung des Anlaufmanagements komplexer Montagesysteme
Betreuer: Prof. Dr. Egon Müller
2007-04-24 Mucha, Herbert
Untersuchungen zur Porositätsentwicklung von Phenolharzen als polymere Kohlenstoffspendermatrices in C-Faserverbundwerkstoffen
Betreuer: Prof. Dr. Bernhard Wielage
2007-04-23 Ehrenheim, Christoph
Produktions- und Prozessoptimierung mit Hilfe von Kennzahlensystemen
Betreuer: Prof. Dr. Egon Müller
2007-01-24 Shalaby, Hemdan
On the potential of large eddy simulation to simulate cyclone separators (online verfügbar)
Betreuer: Prof. Dr. Günter Wozniak
2007-01-19 Roth, Stefan
Spritzgegossene Abschirmgehäuse aus stahlfasergefüllten Thermoplasten - Materialeigenschaften, Verarbeitung und Gestaltung (online verfügbar)
Betreuer: Prof. Dr. Günter Mennig
2007-01-09 Wittstock, Volker
Piezobasierte Aktor-Sensor-Einheiten zur uniaxialen Schwingungskompensation in Antriebssträngen von Werkzeugmaschinen
Betreuer: Prof. Dr. Reimund Neugebauer
2006-12-18 Löschmann, Frank
Anlagentechnische Grundlagen für die Elektromagnetumformung im Automobilbau
Betreuer: Prof. Dr. Reimund Neugebauer
2006-12-12 Dietrich, Stephan
Grundlagenuntersuchungen zu neuen matrizenlosen Umformfügeverfahren
Betreuer: Prof. Dr. Reimund Neugebauer
2006-12-11 Ecke, Ramona
Abscheidung (CVD) und Charakterisierung W-basierter Diffusionsbarrieren für die Kupfermetallisierung
Betreuer: Prof. Dr. Bernhard Wielage
2006-12-01 Forbrig, Frank
Untersuchungen zur Gestaltfestigkeit von Passfederverbindungen
Betreuer: Prof. Dr. Erhard Leidich
2006-11-24 Liepack, Otfrid
Anwendung des Systems Engineering zur Verbesserung des Betriebes von planetaren Missionen
Betreuer: Prof. Dr. Egon Müller
2006-11-17 Steiner, Ralf
Kompetenzzellenbasierte Produktentwicklung (online verfügbar)
Betreuer: Prof. Dr. Reimund Neugebauer
2006-10-24 Martens, Knut
Werkzeugwechselkonzepte für Bearbeitungszentren mit kurzer Werkzeugeingriffszeit
Betreuer: Prof. Dr. Reimund Neugebauer
2006-10-13 Thiele, Reiko
Untersuchungen zur Zahnfußbeanspruchung von Schneckenrädern und Entwicklung eines Tragfähigkeitsnachweises auf der Basis der Zahnfußschädigungshypothese
Betreuer: Prof. Dr. Erhard Leidich
2006-09-29 Patcharaphun (m), Somjate
Characterization and Simulation of Material Distributation and Fiber Orientation in Sandwich Injection Molded Parts
Betreuer: Prof. Dr. Günter Mennig
2006-08-16 Banik (m), Kaushik
Prozessinduziertes Langzeitdeformationsverhalten von spritzgegossenen teilkristallinen Kunststoffen
Betreuer: Prof. Dr. Günter Mennig
2006-07-20 Manuelli, Alessandro
Influences of printing techniques on the electrical performances of conjugated polymers for organic transistors
Betreuer: Prof. Dr. Arved Hübler
2006-07-06 Ufer, René
Modellierung und Simulation von Drückwalzprozessen
Betreuer: Prof. Dr. Birgit Awiszus
2006-07-03 Li (m), Bincheng
Analyse und Simulation des Transversalschwingungseinflusses von Riemengetrieben auf Fehler der Werkstückoberfläche
Betreuer: Prof. Dr. Reimund Neugebauer
2006-06-23 Seitz, Bernhard
Optimierung der technischen Unternehmensführung mittels gewichteter Kennzahlen für klein- und mittelständische Unternehmen der Lackindustrie
Betreuer: Prof. Dr. Egon Müller
2006-03-31 Dimitrova, Krassimira Georgieva
Thermische Effekte im Kollektorfeld solarthermischer Anlagen
Betreuer: Prof. Dr. Bernd Platzer
2005-12-02 Todtermuschke, Marcel
Verfahrensoptimierung zur Herstellung einer punktförmigen, mechanisch gefügten, einseitig ebenen Verbindung ohne Verbindungselement
Betreuer: Prof. Dr. Klaus-Jürgen Matthes
2004-10-04 Riedel , Frank
Habilitation!Möglichkeiten der Optimierung von punktförmigen, form- und kraftschlüssigen Feinblechverbindungen
Betreuer: Prof. Dr. Klaus-Jürgen Matthes

Presseartikel