Veröffentlichungen
Publikationsliste
Investigation of the effect of copper content added to aluminum on cutting force in MQL turning (Ficici, Ferit; Ozdemir, Ismail*; Grund, Thomas; Lampke, Thomas)
Hardening by annealing in the medium-entropy alloy CrCoNi after equal-channel angular pressing (Rymer, Lisa-Marie*; Höppel, Heinz Werner; Ortner, Patrick; Pfeffer, Nina; Stark, Andreas; Winter, Lisa; Lampke, Thomas)
Fatigue strength prediction in incrementally formed sheet-parts with varying residual stresses (Bergelt, Tim*; Winter, Lisa; Härtel, Markus; Grünewald, Steffen; Rymer, Lisa-Marie; Maaß, Fabian; Joghan, Hamed Dardaei; Korkolis, Yannis P.; Tekkaya, A. Erman; Lampke, Thomas)
Intelligent Decision Support in Thermal Spraying Through AI Modeling of Small and Smart Data: A Case Study on HVAF- and HVOF-Sprayed WC-CoCr Coatings (Bocklisch, Franziska*; Lanz, Oliver; Torkashvand, Kaveh; Bocklisch, Steffen; Lampke, Thomas; Joshi, Shrikant)
Velocity-dependent shear band formation in blanking processes (Winter, Lisa*; Winter, Sven; Martinitz, Katja; Schrage, Olaf; Schottstedt, Luisa; Böhme, Marcus; Scholze, Mario; Hahn, Marlon; Drehmann, Rico; Psyk, Verena; Wagner, Martin F.-X.; Volk, Wolfram; Korkolis, Yannis P.; Lampke, Thomas)
Numerical Investigation Method for the Determination of Electro- and Plasma-Chemical Portions in Current Signals from Plasma Electrolytic Oxidation Processes (Schwöbel, Stephan Daniel*; Simchen, Frank; Mehner, Thomas; Lampke, Thomas)
Strain-induced microstructural and precipitation behavior of Al-MG-Si-Mn alloys: Effect of Si content under controlled thermomechanical conditions (Lypchanskyi, Oleksandr*; Rigas, Nikolaos; Rogal, Łukasz; Janus, Karol; Litynska-Dobrzynska, Lidia; Korpalaf, Grzegorz; Lampke, Thomas; Merklein, Marion; Prahl, Ulrich)
NiCrBSi-based coatings with WC-Co reinforcement and h-BN solid lubrication: microstructure and wear behavior after flame and HVOF spraying with flame fusing (Lypchanskyi, Oleksandr*; Preuß, Bianca; Wisniewski, Wolfgang; Grimm, Maximilian; Grund, Thomas; Schulz, Marvin; Wietheger, Wolfgang; Undisz, Andreas; Lampke, Thomas)
FAST-Sintered Cu/Cf Composites: Wear and Corrosion Characteristics (Özdemir, Ismail*; Grund, Thomas; Lampke, Thomas)
Comparative Analysis of HVAF and Cold Spray Methods for Aluminum Alloy Coatings for Engine Bearings (Özdemir, Ismail*; Grund, Thomas; Joshi, S.; Björklund, S.; Bulbul, B.; Drehmann, Rico; Lampke, Thomas)
Influence of multiple-pass equal-channel angular pressing and heat treatment on the fatigue threshold of the medium-entropy alloy CrCoNi (Rymer, Lisa-Marie*; Härtel, Markus; Winter, Lisa; Lampke, Thomas)
Development and characterization of an Zr-based electrolyte for the formation of an Al2O3/ZrO2 composite coating through plasma electrolytic oxidation (Albero Rojas, Claudia*; Dodangi, Mohammad; Simchen, Frank; Winter, Lisa; Lampke, Thomas)
Characterisation of Scale Layer Structure and Resulting Mechanical Properties Under Varying Carbon and Chromium Contents (Bergelt, Tim*; Graf, Marcel; Winter, Lisa; Peddinghaus, Simon; Mohnfeld, Norman; Wester, Hendrik; Uhe, Johanna; Behrens, Bernd-Arno; Lampke, Thomas)
Tailoring magnesium alloys via plasma electrolytic oxidation: Emerging drug delivery pathways in biodegradable implant technologies - A review (Fattah-alhosseini, Arash*; Chaharmahali, Razieh; Dikici, Burak*; Lampke, Thomas*)
Final Report of DFG project "Influence of twinning effects and grain size distribution on the crack propagation behavior of medium-entropy alloy CrCoNi through severe plastic deformation and heat treatment (Rymer, Lisa-Marie; Winter, Lisa; Lampke, Thomas*)
Layer-thickness determination based on grazing-incidence X-ray diffraction under consideration of specimen curvature and roughness (Mehner, Thomas*; Dittes, Axel; Clauß, Steffen; Dodangi, Mohammad; Köhler, Sandra; Clausmeyer, Till; Awiszus, Birgit; Lampke, Thomas)
Model Adjustments and Solver Construction for Galvanic Cells Based on NPP-Systems (Schwöbel, Stephan Daniel*; Mehner, Thomas; Lampke, Thomas)
Ultra-short austenitization and thermal cycle effects in martensitic stainless steel: phase transformation kinetics and carbide evolution (Lypchanskyi, Oleksandr*; Grund, Thomas; Johari, Mojtaba; Xu, Yakun; Kunke, Andreas; Clausmeyer, Till; Lampke, Thomas)
Wear and corrosion properties of SLM-manufactured 17-4PH components: Comparison of the effects of solution heat treatment, aging, and combined treatments (Wang, Zechen*; Grimm, Maximilian; Lindner, Thomas; Schubert, Frank; Winkler, Kerstin; Lampke, Thomas)
Infrared thermography of thermal spray coating processes as quality monitoring tool (Lindner, Thomas*; Kaur, Sahib; Grimm, Maximilian; Schlegel, Kay; Lampke, Thomas)
Effect of Nb0.5 and Mo0.75 addition on in-vitro corrosion and wear resistance of high-speed laser metal deposited Al0.3CrFeCoNi high-entropy alloy coatings (Dikici, Burak*; Lindner, Thomas; Lampke, Thomas*; Grund, Thomas; Gunay Bulutsuz, Asli)
Advancements in cold spraying for polymer matrix composites: enhanced LSP and EMI shielding performance - review and future directions (Karahan, Bugra; Ozdemir, Ismail*; Grund, Thomas; Hanisch, Niclas; Lampke, Thomas)
Damage evolution of Cu-inductors used for electromagnetic forming (Rymer, Lisa-Marie*; Winter, Lisa; Linnemann, Maik; Winter, Sven; Psyk, Verena; Lampke, Thomas)
High-cycle fatigue behavior of high-speed blanked 5754 aluminum sheets (Winter, Lisa*; Winter, Sven; Psyk, Verena; Drehmann, Rico; Lampke, Thomas)
Theoretical investigations and methodology for modeling and direct simulation of electrochemical pulse plating in the diffusion boundary layer (Schwöbel, Stephan D.*; Mehner, Thomas; Lampke, Thomas)
Fraktale Gestaltungsprinzipien zur definierten Einstellung der interlaminaren Festigkeit von Metall-Thermoplast-Verbunden (Lampke, Thomas*; Schubert, Andreas*; Steinert, Philipp; Hanisch, Niclas; Liborius, Hendrik; Lindner, Thomas; Nestler, Andreas; Schaarschmidt, Ingo)
Scale influence in surface design regarding laser structures for adhesion enhancement in polymer-metal hybrids: A fractal dimension approach (Hanisch, Niclas*; Steinert, Philipp; Lindner, Thomas; Liborius, Hendrik; Schubert, Andreas; Lampke, Thomas)
Enhanced surface finishing of selective laser melted 17-4PH steel by a novel two-step electrolyte plasma polishing process (Wang, Zechen*; Grimm, Maximilian; Lindner, Thomas; Schubert, Frank; Winkler, Kerstin; Weise, Tobias; Lampke, Thomas)
Enhancing corrosion resistance and radiation shielding of AlSl 304 SS with Nb and Mo-added Al0.3CrFeCoNi-based high-entropy alloy coatings in 3.5wt% NaCl: The Effect of environmental temperature (Dikici, Burak*; Lindner, Thomas; Sakar, Erdem*; Lampke, Thomas*; Seifzadeh, Davod; Grund, Thomas; Kamaci, Kübra)
Microstructure and wear resistance of environmentally friendly NbC-FeCr coatings: An evaluation of HVOF process parameters (Tegelkamp, Lukas*; Grimm, Maximilian; Conze, Susan; Berger, Lutz-Michael; Lindner, Thomas; Lampke, Thomas)
Enhanced Wear Resistance of Gas Nitrided AlSl 431 HVOF Coatings at Elevated Temperatures (Hanisch, Niclas*; Saborowski, Erik; Lindner, Thomas; Preuß, Bianca; Tchinou, Serge; Börner, Kristian; Lampke, Thomas)
On the relationship between particle melting degree and phase transformation of alumina and alumina-based solid solution powders during atmospheric plasma spraying (Grimm, Maximilian*; Conze, Susan; Berger, Lutz-Michael; Lampke, Thomas)
Microstructural and mechanical properties of a hard anodic coating applied on an elastically pre-strained aluminum substrate (Thomas George, Linto*; Winter, Lisa; Simchen, Frank; Breitfeld, Tobias; Lampke, Thomas)
Micro-scratch tests as method for determining the wear resistance of high-speed blanked surfaces (Winter, Lisa*; Drehmann, Rico; Lampke, Thomas)
Two-Step Plasma Electrolytic Oxidation of Advanced High-Strength Steel in Aluminate and Silicate Solutions (Morgenstern, Roy*; Mehner, Thomas; Lampke, Thomas)
Particle-plasma interactions: particle melting state and its impact on the phase composition and deposition efficiency in atmospheric plasma sprayed alumina coatings (Grimm, Maximilian*; Lindner, Thomas; Lampke, Thomas)
Semi-additive manufacturing of metal-polymer hybrid parts by direct material extrusion onto anodized and onto organosilicate-coated aluminum (Dittes, Axel*; Bretschneider, Eric; Hanisch, Niclas; Mehner, Thomas; Segel, Frank; Lehmann, Lars; Gröger, Sophie; Wünsch, Florian; Ihlemann, Jörn; Lampke, Thomas)
Combined Effect of Particle Reinforcement and T6 Heat Treatment on the Compressive Deformation Behavior of an A357 Aluminum Alloy at Room Temperature and at 350 °C (Hirsch, Sarah Johanna*; Berndt, Nadja; Grund, Thomas; Lampke, Thomas)
Quantitative Model for the Prediction of the Corrosion Rate of cold-rolled 316L Steel (Dittes, Axel*; Mehner, Thomas; Friedrich, Sandra; Awiszus, Birgit; Lampke, Thomas)
Hybrid decision-making in atmospheric plasma spraying enables human-machine teaming (Bocklisch, Franziska*; Bocklisch, Steffen F.; Grimm, Maximilian; Lampke, Thomas; Joshi, Shrikant)
Towards a Cognition-Based Framework Describing Interdisciplinary Expert Team Processes for Cognitive Robotics in Industry 5.0 Technologies (Morgenstern, Tina; Klichowicz, Anja; Bengler, Philip; Todtermuschke, Marcel; Bocklisch, Franziska*)
Development of CoCr0.65FeNi-BSiC as a self-fluxing high-entropy alloy for thermal spraying (Preuß, Bianca*; Lindner, Thomas; Kaur, Sahib; Cabrera, Jorge Eduardo Tapia; Hanisch, Niclas; Schwarz, Thomas; Lampke, Thomas)
Wear and Corrosion Resistant Eutectic High-Entropy Alloy AI0.3CoCrFeNiMo0.75 Produced by Laser Metal Deposition and Spark-Plasma-Sintering (Preuß, Bianca*; Lindner, Thomas; Uhlig, Thomas; Mehner, Thomas; Töberling, G.; Wagner, Guntram; Lampke, Thomas)
Comparison of 2D and 3D measurement methods for evaluating laser structured aluminum surfaces using fractal dimension (Hanisch, Niclas*; Steinert, Philipp; Saborowski, Erik; Liborius, Hendrik; Lindner, Thomas; Bandaru, Nithin Kumar; Schubert, Andreas; Lampke, Thomas)
The combination of diamond smoothing and intermediate cooling during wire arc spraying of Ni-5w%Al on 1.0032 to improve the high-cycle fatigue behavior (Rymer, Lisa-Marie*; Winter, Lisa; Liborius, Hendrik; Lindner, Thomas; Schubert, Andreas; Lampke, Thomas)
Forming Behavior of Additively Manufactured Al/Ti Material Compounds Produced by Cold Spraying (Drehmann, Rico*; Colditz, Pascal; Graf, Marcel; List, Alexander; Gärtner, Frank; Awiszus, Birgit; Lampke, Thomas)
Wear Performance Evaluation of Polymer Overlays on Engine Bearings (Özdemir, Ismail*; Bulbul, Bahattin; Kiracbedel, Ugur; Grund, Thomas; Lampke, Thomas)
Investigation of Tribological Behavior of PTFE Composites Reinforced with Bronze Particles by Taguchi Method (Ficici, Ferit; Özdemir, Ismail*; Grund, Thomas; Lampke, Thomas)
Characterization of ZnO-Doped Hydroxyapatite Coatings on PEEK Made by Hybrid Plasma Spraying Process for Biomedical Applications (Xu, Jun; Pfuch, Andreas; Seemann, Thomas; Fröhlich, Frank; Schweder, Martina; Lampke, Thomas*)
Surface Functionalization of Novel Work-Hardening Multi-Principal-Element Alloys by Ultrasonic Assisted Milling (Preuß, Bianca*; Lindner, Thomas; Hanisch, Niclas; Giese, Marcel; Schröpfer, Dirk; Richter, Tim; Rhode, Michael; Lampke, Thomas)
Wear and corrosion properties of low-temperature nitrocarburized 17-4PH SLM components (Wang, Zechen*; Grimm, Maximilian; Lindner, Thomas; Schubert, Frank; Winkler, Kerstin; Berger, Robin; Lampke, Thomas)
Quantitative design criterion for mechanical interface functionalization regarding adhesion strength in chemically pre-treated polymer-metal hybrids using fractal dimension (Hanisch, Niclas*; Dittes, Axel; Steinert, Philipp; Liborius, Hendrik; Lindner, Thomas; Schubert, Andreas; Lampke, Thomas)
Human-CoMo: A combination of cognitive knowledge engineering and data modelling for human-cyber-physical systems in intelligent manufacturing (Bocklisch, Franziska*; Lampke, Thomas)
Enhanced Wear Resistance of Gas Nitrided AISI 431 HVOF Coatings at Elevated Temperatures (Hanisch, Niclas*; Saborowski, Erik; Lindner, Thomas; Preuß, Bianca; Tchinou, Serge; Börner, K.; Lampke, Thomas)
Experimental and FE Investigation on the Influence of Impact Load on the Moment Transmission of Smooth Shaft–Hub Connections (Härtel, Markus*; Le Duc, Loc*; Grund, Thomas; Suchy, Lukas; Lampke, Thomas; Hasse, Alexander)
Entwicklung festschmierstoffmodifizierter, selbstfließender Legierungen zur Reibwertreduzierung (Preuß, Bianca*; Lampke, Thomas)
Einlaufverhalten tribologisch beanspruchter Oberflächen - neue Methode der Bewertung und Vorhersage der Einlaufdauer (Hirsch, Sarah Johanna*; Lampke, Thomas)
Pin-Shaped Surface Structures Generated by Laser Single Pulse Drilling for High-Strength Interfaces in Thermally Joined Polymer-Metal Hybrids (Saborowski, Erik*; Steinert, Philipp; Lindner, Thomas; Schubert, Andreas; Lampke, Thomas)
Investigation of the Tribological Behaviour of Various AMC Surfaces against Brake Lining Material (Hirsch, Sarah Johanna*; Eiselt, Patrick; Ozdemir, Ismail; Grund, Thomas; Nestler, Andreas; Lampke, Thomas; Schubert, Andreas)
How automation level influences moral decisions of humans collaborating with industrial robots in different scenarios (Eich, Anne; Klichowicz, Anja; Bocklisch, Franziska*)
Microstructure Evolution and Wear Resistance of the Eutectic High-Entropy Alloy Al0.3CoCrFeNiNb0.5 Produced by Laser Metal Deposition (Preuß, Bianca*; Lindner, Thomas; Uhlig, Thomas; Tapia Cabrera, Jorge Eduardo; Schwarz, Holger; Wagner, Guntram; Seyller, Thomas; Lampke, Thomas)
Towards Closed-Loop Recycling of Ceramic Particle-Reinforced Aluminium Alloys: Comparative Study of Resistance-Heating Sintered Primary and Solid-State Recycled Secondary SiCp/AlSi7Mg Composites (Hirsch, Sarah Johanna*; Grund, Thomas; Lampke, Thomas)
Analytical Models for Grain Size Determination of Metallic Coatings and Machined Surface Layers Using the Four-Point Probe Method (Mehner, Thomas*; Lampke, Thomas)
Humans and cyber-physical systems as teammates? Characteristics and applicability of the human-machine-teaming concept in intelligent manufacturing (Bocklisch, Franziska*; Huchler, Norbert)
Niobium and Molybdenum as Alloying Constituents in Al0.3CoCrFeNi to Develop Eutectic High-Entropy Alloys for HVOF Spraying (Preuß, Bianca*; Lindner, Thomas; Uhlig, Thomas; Wagner, Guntram; Lampke, Thomas)
To Share or Not to Share - Expected Transportation Mode Changes Given Different Types of Fully Automated Vehicles (Heubeck, Laura; Hartwich, Franziska; Bocklisch, Franziska*)
Wear and Corrosion Behavior of Cold-Sprayed Cu-10Sn Coatings (Özdemir, Ismail*; Bulbul, Bahattin; Grund, Thomas; Lampke, Thomas)
Microstructures and property profiles of atmospheric plasma sprayed (Al,Cr,Ti)203 solid solution coatings (Grimm, Maximilian*; Conze, Susan; Berger, Lutz-Michael; Thiele, Sven; Lindner, Thomas; Lampke, Thomas)
Quasi Non-Destructive Quality Assessment of Thermally Sprayed AlSl 316L Coatings Using Polarization Measurements in 3.5% NaCl Gel Electrolyte (Grimm, Maximilian*; Kutschmann, Pia; Pluta, Christian; Schwabe, Olga; Lindner, Thomas; Lampke, Thomas)
Specification of parsitic electrochemical subprocesses during plasma electrolytic oxidation of magnesium (Simchen, Frank*; Schwöbel, Stephan Daniel; Mehner, Thomas; Lampke, Thomas)
Passivation and pH-Induced Precipitation during Anodic Polarization of Steel in Aluminate Electrolytes as a Precondition for Plasma Electrolytic Oxidation (Morgenstern, Roy*; Albero Rojas, Claudia; Simchen, Frank; Meinhold, Vanessa; Mehner, Thomas; Lampke, Thomas)
Enhanced high-temperature wear behavior of high-speed laser metal deposited Al0.3CrFeCoNi coatings alloyed with Nb and Mo (Rymer, Lisa-Marie*; Lindner, Thomas; Lampke, Thomas)
Fatigue Resistance of an Anodized and Hardanodized 6082 Aluminum Alloy Depending on the Coating Thickness in the High Cycle Regime (Winter, Lisa*; Lampke, Thomas)
Fracture behaviour of plasma electrolytic oxide coatings on an aluminium substrate using acoustic emission (Albero Rojas, Claudia*; Simchen, Frank; Winter, Lisa; Rymer, Lisa-Marie; Lampke, Thomas)
The Influence of Design on Stress Concentration Reduction in Dental Implant Systems Using the Finite Element Method (Pala, Eser; Özdemir, Ismail*; Grund, Thomas; Lampke, Thomas)
Non-Metallic Alloying Constituents to Develop a Wear-Resistant CrFeNi-BSiC High Entropy Alloy for Surface Protective Coatings by Thermal Spraying and High-Speed Laser Metal Deposition (Lindner, Thomas*; Preuß, Bianca; Löbel, Martin; Rymer, Lisa-Marie; Grimm, Maximilian; Schwarz, Holger; Seyller, Thomas; Lampke, Thomas)
Influence of Aluminum and Molybdenum on the Microstructure and Corrosion Behavior of Thermally Sprayed High-Entropy Alloy Coatings (Löbel, Martin*; Lindner, Thomas; Grimm, Maximilian; Rymer, Lisa-Marie; Lampke, Thomas)
Microstructure and Corrosion Properties of AlCrFeCoNi High-Entropy Alloy Coatings Prepared by HVAF and HVOF (Löbel, Martin*; Lindner, Thomas; Mehner, Thomas; Rymer, Lisa-Marie; Björklund, Stefan; Joshi, Shrikant; Lampke, Thomas)
Electrodeposition of Thick and Crack-Free Fe-Cr-Ni Coatings from a Cr (III) Electrolyte (Meinhold, Vanessa*; Höhlich, Dominik; Mehner, Thomas; Lampke, Thomas)
Mathematical Modeling of the Limiting Current Density from Diffusion-Reaction Systems (Schwoebel, Stephan Daniel*; Mueller, Markus; Mehner, Thomas; Lampke, Thomas)
Comparison of Aqueous and Gelled 3.5% NaCl Electrolytes for Assessing the Corrosion Resistance of Thermal Spray Stainless-Steel Coatings in Electrochemical Corrosion Tests (Kutschmann, Pia*; Grimm, Maximilian; Lindner, Thomas; Ernst, Kerstin Raffaela; Schwabe, Olga; Pluta, Christian; Lampke, Thomas)
Heat Treatment Influencing Porosity and Tensile Properties of Field Assisted Sintered AlSi7Mg0.6 (Hirsch, Sarah Johanna*; Winter, Lisa; Grund, Thomas; Lampke, Thomas)
Evolution of Microstructure and Hardness of the Nitrided Zone during Plasma Nitriding of High-Alloy Tool Steel (Landgraf, Pierre*; Bergelt, Tim; Rymer, Lisa-Marie; Kipp, Christian; Grund, Thomas; Bräuer, Günter; Lampke, Thomas)
Effects of Laser-Remelting on the Microstructure, Hardness and Oscillating Wear Resistance of Atmospheric Plasma Sprayed Alumina-Rich Coatings (Grimm, Maximilian*; Lindner, Thomas; Lampke, Thomas)
High-Speed Laser Metal Deposition of CrFeCoNi and AlCrFeCoNi HEA Coatings with Narrow Intermixing Zone and Their Machining by Turning and Diamond Smoothing (Lindner, Thomas*; Liborius, Hendrik; Töberling, Gerd; Vogt, Sabrina; Preuß, Bianca; Rymer, Lisa-Marie; Schubert, Andreas; Lampke, Thomas)
Influence of Hydrothermal Sealing on the High Cycle Fatigue Behavior of the Anodized 6082 Aluminum Alloy (Winter, Lisa*; Lampke, Thomas)
Dissolution Behavior of Different Alumina Phases within Plasma Electrolytic Oxidation Coatings (Simchen, Frank*; Morgenstern, Roy; Clauß, Steffen; Mehner, Thomas; Lampke, Thomas)
Silicate and Hydroxide Concentration Influencing the Properties of Composite Al2O3-TiO2 PEO Coatings on AA7075 Alloy (Hashemzadeh, Mehri*; Raeissi, Keyvan*; Ashrafizadeh, Fakhreddin; Hakimizad, Amin; Santamaria, Monica; Lampke, Thomas)
Cold Gas Spraying of Solution-Hardened 316L Grade Stainless Steel Powder (Lindner, Thomas*; Löbel, Martin; Grimm, Maximilian; Fiebig, Jochen)
Integrating Human Cognition in cyber-physical systems: A multidimensional fuzzy pattern model with application to thermal spraying (Bocklisch, Franziska*; Paczkowski, Gerd; Zimmermann, Stephan; Lampke, Thomas)
Enhanced Abrasion Resistance of Spark Plasma Sintered and HVOF Sprayed Hadfield High Manganese Steel by Turning and Diamond Smoothing (Lindner, Thomas*; Liborius, Hendrik; Preuß, Bianca; Hanisch, Niclas; Schubert, Andreas; Lampke, Thomas)
Niobium and Molybdenum as Alloying Constituents in Al0.3CoCrFeNi to Develop Eutectic High-Entropy Alloys for HVOF Spraying (Preuß, Bianca*; Lindner, Thomas; Uhlig, Thomas; Wagner, Guntram; Lampke, Thomas)
Modelling of layer development and nitrogen distribution on different microstructures during plasma nitriding (Bergelt, Tim*; Landgraf, Pierre; Grund, Thomas; Bräuer, G.; Lampke, Thomas)
Influence of the Current Regime during Electrodeposition in a Cr(III)-Containing Fe-Cr-Ni Electrolyte on the Near-Surface pH, Alloy Composition, and Microcrack Behavior (Meinhold, Vanessa; Höhlich, Dominik*; Mehner, Thomas; Lampke, Thomas)
Knowledge matters! - Exploring Drivers and Barriers in the Acceptance of FCEVs as a Sustainable Mobility Solution (Kreißig, Isabel*; Bocklisch, Franziska*)
Nb and Mo Influencing the High-Temperature Wear Behavior of HVOF-Sprayed High-Entropy Alloy Coatings (Rymer, Lisa-Marie*; Lindner, Thomas; Lampke, Thomas)
Influence of the finish-machining by turning and diamond smoothing on the tribological properties of Fe17Cr2Ni0.2C thermally sprayed coatings (Liborius, Hendrik; Grund, Thomas*; Nestler, Andreas; Paczkowski, Gerd; Schubert, Andreas; Lampke, Thomas)
Influence of Pre-Aging on the Artificial Aging Behavior of a 6056 Aluminum Alloy after Conventional Extrusion (Winter, Lisa*; Hockauf, Kristin; Scholze, Mario; Hellmig, Ralph Jörg; Lampke, Thomas)
Irregular Electrodeposition of Cu-Sn Alloy Coatings in [EMIM]Cl Outside the Glove Box with Large Layer Thickness (Lehmann, Lars*; Höhlich, Dominik; Mehner, Thomas; Lampke, Thomas)
On a Robust and Efficient Numerical Scheme for the Simulation of Stationary 3-Component Systems with Non-Negative Species-Concentration with an Application to the Cu Deposition from a Cu-(β-alanine)-Electrolyte (Schwoebel, Stephan Daniel*; Mehner, Thomas; Lampke, Thomas)
Enhancement of the Adhesion of Wire Arc Sprayed Coatings on Carbon Fiber-Reinforced Plastic by Surface Laser Structuring (Gustke, Kevin*; Gebauer, Jana; Drehmann, Rico; Lasagni, Andrés Fabián; Lampke, Thomas)
Nickel-Aluminum Thermal Spray Coatings as Adhesion Promoter and Susceptor for Inductively Joined Polymer-Metal Hybrids (Saborowski, Erik*; Dittes, Axel; Lindner, Thomas; Lampke, Thomas)
Stabilization of the Computation of Stability Constants and Species Distributions from Titration Curves (Schwoebel, Stephan Daniel*; Höhlich, Dominik; Mehner, Thomas; Lampke, Thomas)
Prediction of residual-stress depth profiles in turning of EN AW-2017 based on in-process measurements of machining forces and temperatures (Mehner, Thomas*; Junge, Thomas; Schubert, Andreas; Lampke, Thomas)
Jominy End Quench Test of Martensitic Stainless Steel X30Cr13 (Landgraf, Pierre*; Birnbaum, Peter; Meza-García, Enrique; Grund, Thomas; Kräusel, Verena; Lampke, Thomas)
Suitability of roughness parameters for the interlaminar strength prediction of mechanically interlocked polymer-metal-interfaces (Saborowski, Erik*; Steinert, Philipp; Dittes, Axel; Lindner, Thomas; Schubert, Andreas; Lampke, Thomas)
Influence of Thermochemical Treatment on the Surface Properties of Finish Turned Wire Arc Sprayed 17Cr Steel Coatings (Kutschmann, Pia*; Lindner, Thomas; Liborius, Hendrik; Grund, Thomas; Schubert, Andreas; Lampke, Thomas)
Experimental and Numerical Investigations into Magnetic Pulse Welding of Aluminum Alloy 6016 to Hardened Steel 22MnB5 (Drehmann, Rico*; Scheffler, Christian; Winter, Sven; Psyk, Verena; Kräusel, Verena; Lampke, Thomas)
Microstructure and Wear Behavior of the High-Velocity-Oxygen-Fuel Sprayed and Spark Plasma Sintered High-Entropy Alloy AlCrFeCoNi (Löbel, Martin*; Lindner, Thomas; Clauß, Steffen; Pippig, Robert; Dietrich, Dagmar; Lampke, Thomas)
Artificial aging time influencing the crack propagation behavior of the aluminum alloy 6060 processed by equal channel angular pressing (Rymer, Lisa-Marie*; Winter, Lisa; Hockauf, Kristin; Lampke, Thomas)
Electrodeposition of FeCrNi and FeCr alloys and influence of heat treatment on microstructure and composition (Meinhold, Vanessa*; Höhlich, Dominik; Dittes, Axel; Mehner, Thomas; Lampke, Thomas)
Electrolyte design and characterization of REACh-compliant Zn-W and Zn-W-Cu electrodeposits (Morgenstern, Roy*; Müller, M.; Höhlich, Dominik; Mehner, Thomas; Lampke, Thomas)
Conversion layers by plasma-electrolytic oxidation of aluminum in acrylate and benzoate electrolytes (Morgenstern, Roy*; Selyshchev, Oleksandr; Mehner, Thomas; Lampke, Thomas; Zahn, Dietrich R. T.; Goedel, W.A.; Schreckenbach, J.)
Mathematical modeling and simulation of the dissolution of zinc anodes in industrial electroplating (Schwöbel, Stephan Daniel*; Meinhold, Vanessa; Mehner, Thomas; Lampke, Thomas)
Formation of corundum-rich alumina coatings on low-carbon steel by plasma electrolytic oxidation (Simchen, Frank*; Masoud-Nia, N.; Mehner, Thomas; Lampke, Thomas)
Influence of the production route on the phase formation, microstructure and wear behaviour of the high-entropy alloy AlCoCrFeNiTi0.5 (Löbel, Martin*; Lindner, Thomas; Lampke, Thomas)
Chemical structure of amino-terminated alkyl silanes influencing the strength of aluminum-polyamide joints (Dittes, Axel*; Scharf, Ingolf; Lehmann, Lars; Saborowski, Erik; Mehner, Thomas; Lampke, Thomas)
Influence of metal matrix powder size on the tensile strength of a SiCp/AlSi7Mg0,6 composite produced by field assisted sintering technique (Pippig, Robert*; Hirsch, Sarah Johanna*; Grund, Thomas*; Lampke, Thomas*)
High temperature treatment effects on the microstructure and properties of a plasma sprayed 25 mol% Al2O3-25 mol% Cr2O3-50 mol% TiO2 coating (Grimm, Maximilian*; Conze, S.; Berger, L.-M.; Drehmann, Rico; Lampke, Thomas)
Influence of the wire diameter and particle fraction of Fe-Al2O3/ZrO2 flux-cored wires processed by wire arc spraying on the abrasive wear properties of the coating (Gustke, Kevin*; Drehmann, Rico; Lampke, Thomas)
Electrochemical testing of thermal spray coatings using gel electrolytes (Kutschmann, Pia*; Lindner, Thomas; Grimm, Maximilian; Lampke, Thomas)
High-temperature wear behaviour of borided Inconel 718 HVOF coatings (Löbel, Martin*; Lindner, Thomas; Hanisch, Niklas; Lampke, Thomas)
Coupled experimental and simulative investigation of the influence of polymer moisture content on the strength of amino-silane-mediated aluminum polyamide 6 joints (Kießling, R.; Dittes, Axel*; Lampke, Thomas; Ihlemann, Jörn)
Introduction to Plasma Electrolytic Oxidation - An Overview of the Process and Applications (Simchen, Frank*; Sieber, Maximilian; Kopp, Alexander; Lampke, Thomas)
On the Q&P Potential of a Commercial Spring Steel (Härtel, Markus*; Wilke, Alisa*; Dieck, Sebastian; Landgraf, Pierre; Grund, Thomas; Lampke, Thomas; Neukirchner, Heiko; Halle, Thorsten; Wappler, Sebastian)
Influence of Pre-Aging on the Hardness and Formability of a Thread Rolled 6056 Aluminum Alloy after Conventional Extrusion and Artificial Aging (Winter, Lisa*; Hellmig, Ralph Jörg; Hockauf, Kristin; Lampke, Thomas)
Microstructure and Properties of Atmospheric Plasma Sprayed (Al,Cr)2O3–TiO2 Coatings from Blends (Grimm, Maximilian*; Conze, Susan; Berger, Lutz-Michael; Drehmann, Rico; Lampke, Thomas)
Boriding of Laser-Clad Inconel 718 Coatings for Enhanced Wear Resistance (Lindner, Thomas*; Günen, Ali; Töberling, Gerd; Vogt, Sabrina; Karakas, Mustafa Serdar; Löbel, Martin; Lampke, Thomas)
Strain-Rate Sensitive Deformation Behavior under Tension and Compression of Al0.3CrFeCoNiMo0.2 (Rymer, Lisa-Marie*; Frint, Philipp; Lindner, Thomas; Gebel, G.; Löbel, Martin; Lampke, Thomas)
Microstructure and Sliding Wear Resistance of Plasma Sprayed Al2O3-Cr2O3-TiO2 Ternary Coatings from Blends of Single Oxides (Grimm, Maximilian*; Conze, Susan; Berger, Lutz-Michael; Paczkowski, Gerd; Lindner, Thomas; Lampke, Thomas)
Wear and Corrosion Behaviour of Supersaturated Surface Layers in the High-Entropy Alloy Systems CrMnFeCoNi and CrFeCoNi (Lindner, Thomas*; Löbel, Martin; Saborowski, Erik; Rymer, Lisa-Marie; Lampke, Thomas)
Introducing Fractal Dimension for Interlaminar Shear and Tensile Strength Assessment of Mechanically Interlocked Polymer - Metal Interfaces (Saborowski, Erik*; Steinert, Philipp; Dittes, Axel; Lindner, Thomas; Schubert, Andreas; Lampke, Thomas)
Simultaneous Electrodeposition of Silver and Tungsten from [EMIm]Cl:AlCl3 Ionic Liquids outside the Glove Box (Höhlich, Dominik*; Mehner, Thomas; Scharf, Ingolf; Lampke, Thomas)
Introduction to Plasma Electrolytic Oxidation : An Overview of the Process and Applications (Simchen, Frank*; Sieber, Maximilian; Kopp, Alexander; Lampke, Thomas)
Equal-channel angular pressing influencing the mean stress sensitivity in the high cycle fatigue regime of the 6082 aluminum alloy (Winter, Lisa*; Hockauf, Kristin; Winter, Sven; Lampke, Thomas)
High-temperature wear behaviour of AlCoCrFeNiTi0.5 coatings produced by HVOF (Löbel, Martin*; Lindner, Thomas; Lampke, Thomas)
Characterisation Method of the Passivation Mechanisms during the pre-discharge Stage of Plasma Electrolytic Oxidation indicating the Mode of Action of Fluorides in PEO of Magnesium (Simchen, Frank*; Sieber, Maximilian; Mehner, Thomas; Lampke, Thomas)
Precipitation Hardening of the HVOF Sprayed Single-Phase High-Entropy Alloy CrFeCoNi (Löbel, Martin*; Lindner, Thomas; Hunger, Ralph; Berger, Robin; Lampke, Thomas)
Boriding of HVOF-sprayed Inconel 625 coatings (Lindner, Thomas*; Löbel, Martin; Hunger, Ralph; Berger, Robin; Lampke, Thomas)
Changes in the Coating Composition Due to APS Process Conditions Al2O3-Cr2O3-TiO2 Ternary Powder Blends (Grimm, Maximilian*; Conze, Susan; Berger, Lutz-Michael; Paczkowski, Gerd; Drehmann, Rico; Lampke, Thomas)
Designing (Ultra)Fine-Grained High-Entropy Alloys by Spark Plasma Sintering and Equal-Channel Angular Pressing (Rymer, Lisa-Marie*; Lindner, Thomas; Frint, Philipp; Löbel, Martin; Lampke, Thomas)
Analytical Model to Calculate the Grain Size of Bulk Material Based on Its Electrical Resistance (Mehner, Thomas*; Uland, Morgan; Lampke, Thomas)
High-temperature wear behavior of AlCoCrFeNiTi0.5 coatings produced by HVOF (Löbel, Martin*; Lindner, Thomas; Lampke, Thomas)
Determination of the strength of polymer-metal interfaces under mixed mode loading using butt-bonded hollow cylinders (Saborowski, Erik*; Kießling, Robert; Dittes, Axel; Paczkowski, Gerd; Ihlemann, Jörn; Lampke, Thomas)
Mechanisms of fatigue crack propagation in a Q&P-processed steel (Hockauf, Kristin*; Wagner, Martin Franz-Xaver; Masek, Bohuslav; Lampke, Thomas)
Effect of adjusted gas nitriding parameters on microstructure and wear resistance of HVOF-sprayed AISI 316L coatings (Kutschmann, Pia*; Lindner, Thomas; Lampke, Thomas)
High-Temperature Wear Behaviour of Spark Plasma Sintered AlCoCrFeNiTi0.5 High-Entropy Alloy (Löbel, Martin*; Lindner, Thomas; Pippig, Robert; Lampke, Thomas)
Localized anodization of the aluminum alloy EN AW-7075 T6 by closed electrolytic free jet (Morgenstern, R.*; Martin, A.; Lehnert, N.; Scharf, I.; Hackert-Oschätzchen, M.; Schubert, A.; Lampke, Thomas)
Effect of metal surface topography on the interlaminar shear and tensile strength of aluminum / polyamide 6 polymer-metal-hybrids (Saborowski, Erik*; Dittes, Axel; Steinert, Philipp; Lindner, Thomas; Scharf, Ingolf; Schubert, Andreas; Lampke, Thomas)
Hydrogen embrittlement of a quenching and partitioning steel during corrosion and zinc electroplating (Mehner, Thomas*; Scharf, Ingolf; Frint, Philipp; Masek, Bohuslav; Wagner, Martin F.-X.; Lampke, Thomas)
Neural network for prediction of hardness profiles for steel alloys after plasma nitriding (Pribbenow, Jörg*; Mejauschek, M.; Landgraf, Pierre; Grund, Thomas; Bräuer, G.; Lampke, Thomas)
Pitting corrosion behavior of a laser hardened, high-alloyed steel (Mehner, Thomas*; Landgraf, Pierre; Haack, E.; Scharf, Ingolf; Grund, Thomas; Lampke, Thomas)
Influence of the heat-treatment prior to plastic deformation on the aging behavior and the hardness of the aluminium alloy 6056 (Winter, Lisa*; Einer, F.; Geisler, C.; Hellmig, R. J.; Hockauf, Kristin; Lampke, Thomas)
Mean stress sensitivity of the fatigue strength after equal-channel angular pressing of the aluminum alloys 6082 and 6060 (Winter, Lisa*; Hockauf, Kristin; Lampke, Thomas)
Finish Turning of FeCr17Ni2C0.2 Iron-based Sprayed Coatings: Influences of Substrate Preparation, Cutting Speed and Feed on the Coating and Surface Properties (Grund, Thomas*; Paczkowski, Gerd; Lampke, Thomas; Liborius, Hendrik; Nestler, Andreas; Schubert, Andreas)
Mechanically induced grain refinement, recovery and recrystallization of cold-sprayed iron aluminide coatings (Cinca, Núria; Drehmann, Rico*; Dietrich, Dagmar; Gärtner, Frank; Klassen, Thomas; Lampke, Thomas; Guilemany, Jose Maria)
Concepts for interface engineering and characterization in composite hybrid structures (Serna, J.; Zinn, C.; Scharf, Ingolf; Schmidt, C.; Schwöbel, Stephan Daniel; Meiners, D.; Schaper, M.; Lampke, Thomas; Dittes, Axel*)
Influence of titanium on microstructure, phase formation and wear behaviour of AlCoCrFeNiTix High-Entropy Alloy (Löbel, Martin*; Lindner, Thomas; Mehner, Thomas; Lampke, Thomas)
Enhanced Wear Behaviour of Spark Plasma Sintered AlCoCrFeNiTi High-Entropy Alloy Composites (Löbel, Martin*; Lindner, Thomas; Lampke, Thomas)
Temperature and Particle Size Influence on the High Cycle Fatigue Behavior of the SiC Reinforced 2124 Aluminium Alloy (Winter, Lisa*; Hockauf, Kristin; Lampke, Thomas)
Heat treatment condition of EN AW-7075 influencing the anodic oxidation process and coating properties (Morgenstern, Roy*; Scharf, Ingolf; Lampke, Thomas)
Corrosion characteristics of a quenching and partitioning steel determined by electrochemical impedance spectroscopy (Lampke, Thomas; Mehner, Thomas*; Morgenstern, Roy; Frint, Philipp; Scharf, Ingolf; Wagner, Martin F.-X.)
Nondestructive analysis of pitting corrosion characteristics on EN AW-2024-T3 using 3D optical pattern profilometry (Schmidl, Eric; Pippig, Robert*; Morgenstern, Roy; Lampke, Thomas; Scharf, Ingolf)
Plasma Electrolytic Oxidation of High-Strength Aluminium Alloys - Substrate Effect on Wear and Corrosion Performance (Sieber, Maximilian; Simchen, Frank*; Morgenstern, Roy; Scharf, Ingolf; Lampke, Thomas)
Hardening of HVOF-Sprayed Austenitic Stainless-Steel Coatings by Gas Nitriding (Lindner, Thomas*; Kutschmann, Pia; Löbel, Martin; Lampke, Thomas)
Thermal Spray Coatings as an Adhesion Promoter in Metal/FRP Joints (Lindner, Thomas*; Saborowski, Erik; Scholze, Mario; Zillmann, Benjamin; Lampke, Thomas)
Arc Brazing of Aluminium, Aluminium Matrix Composites and Stainless Steel in Dissimilar Joints (Grund, Thomas*; Gester, Andreas; Wagner, Guntram; Habisch, Stefan; Mayr, Peter)
Essential Factors Influencing the Bonding Strength of Cold-Sprayed Aluminium Coatings on Ceramic Substrates (Drehmann, Rico*; Grund, Thomas; Lampke, Thomas; Wielage, Bernhard; Wüstefeld, C.; Motylenko, M.; Rafaja, D.)
High cycle fatigue behavior of the severely plastically deformed 6082 aluminium alloy with an anodic and plasma electrolytic oxide coating (Winter, Lisa*; Hockauf, Kristin; Lampke, Thomas)
Effect of Nitric and Oxalic Acid Addition on Hard Anodizing of AlCu4Mg1 in Sulphuric Acid (Sieber, Maximilian; Morgenstern, Roy*; Scharf, Ingolf; Lampke, Thomas)
Residual-stress evolution of cold-rolled DC04 steel sheets for different initial stress states (Mehner, Thomas*; Bauer, Alexander; Härtel, Sebastian; Awiszus, Birgit; Lampke, Thomas)
Characterization of thermally sprayed copper and numerically supported residual stress determination by the incremental hole-drilling method (Winkler, Ruben*; Saborowski, Erik; Paczkowski, Gerd; Grund, Thomas; Lampke, Thomas)
Phase Stability and Microstructure Evolution of Solution-Hardened 316L Powder Feedstock for Thermal Spraying (Lindner, Thomas*; Löbel, Martin; Lampke, Thomas)
Surface hardening of FCC phase high-entropy alloy system by powder-pack boriding (Lindner, Thomas*; Löbel, Martin; Sattler, Benjamin; Lampke, Thomas)
Microstructure and Wear Resistance of AlCoCrFeNiTi High-Entropy Alloy Coatings Produced by HVOF (Löbel, Martin*; Lindner, Thomas; Mehner, Thomas; Lampke, Thomas)
Downscaled anodic oxidation process for aluminium in oxalic acid (Sieber, Maximilian; Morgenstern, Roy*; Kuhn, Danny; Hackert-Oschätzchen, Matthias; Schubert, Andreas; Lampke, Thomas)
Archaeometric case studies on decorations of pre-Columbian pottery using X-ray spectroscopy maps and profiles (Dietrich, Dagmar*; Mehner, Thomas; Del-Solar-Velarde, N.; Nickel, Daniela; Lampke, Thomas; Chapoulie, R.; Castillo Butters, L. J.)
The potential of EBSD and EDS for ceramics investigations - case studies on sherds of pre-Columbian pottery (Dietrich, Dagmar*; Nolze, G.; Del-Solar-Velarde, N.; Nickel, Daniela; Lampke, Thomas; Chapoulie, R.; Castillo Butters, L. J.)
Electrolyte influence on ignition of plasma electrolytic oxidation processes on light metals (Simchen, Frank*; Sieber, Maximilian; Lampke, Thomas)
Influence of Hardener Content and Curing Parameters on the Microstructure and Mechanical Properties of Porous C/C Composites (Todt, Andreas*; Roder, Kristina; Nier, Natalia; Wielage, Bernhard; Wagner, Guntram; Nestler, Daisy)
Anodic oxidation of AlMgSi1 - Coatings mechanical properties, process costs and energy consumption of the oxide formation (Sieber, Maximilian*; Scharf, Ingolf; Herold, Franziska; Schmidt, Anja; Böttger, Dagmar; Böttger, Sebastian; Böttger, Eckhard; Götze, Uwe; Lampke, Thomas)
Formation of a Spinel Coating on AZ31 Magnesium Alloy by Plasma Electrolytic Oxidation (Sieber, Maximilian*; Simchen, Frank; Scharf, Ingolf; Lampke, Thomas)
Plasma electrolytic polishing o metalized carbon fibers (Böttger-Hiller, Falko*; Nestler, K.; Zeidler, H.; Glowa, G.; Lampke, Thomas)
High-Temperature Corrosion and Radiation Characteristics of Thermal Sprayed Molybdenum Disilicide-Based Coatings (Weis, Sebastian*; Uhlig, Thomas; Wagner, Guntram; Lampke, Thomas*; Bauer, Wolfgang*; Moldenhauer, A.)
Deformation behavior of FRP-metal composites locally reinforced with carbon fibers (Scholze, Mario*; Kolonko, Angelika*; Lindner, Thomas; Lampke, Thomas; Helbig, Frank)
Anodisation with dynamic current control for tailored alumina coatings (Sieber, Maximilian*; Althöfer, I.; Höhlich, Dominik; Scharf, Ingolf; Böttger, D.; Böttger, S.; Böttger, Eckhard; Lampke, Thomas)
Prediction of Austenite Formation Temperatures Using Artificial Neural Networks (Schulze, Pierre*; Schmidl, Eric; Grund, Thomas; Lampke, Thomas)
The effect of plasma electrolytic oxidation on the mean stress sensitivity of the fatigue life of the 6082 aluminium alloy (Winter, Lisa*; Morgenstern, Roy; Hockauf, Kristin; Lampke, Thomas)
Plasma electrolytic oxidation of AMCs (Morgenstern, Roy*; Sieber, Maximilian; Lampke, Thomas)
Surface modification of austenitic thermal-spray coatings by low-temperature nitrocarburizing (Lindner, Thomas*; Mehner, Thomas; Lampke, Thomas)
Anodic oxidation of the AlCu4Mg1 aluminium alloy with dynamic current control (Sieber, Maximilian*; Morgenstern, Roy; Lampke, Thomas)
In-plane biaxial compression and tension testing of thin sheet materials (Zillmann, Benjamin*; Wagner, Martin F.-X.; Schmaltz, Stefan; Schmidl, Eric; Lampke, Thomas; Willner, Kai; Halle, Thorsten)
Corrosion protection of Al/Mg compounds by simultaneous plasma electrolytic oxidation (Sieber, Maximilian*; Morgenstern, Roy; Nickel, Daniela; Scharf, Ingolf; Alisch, Gert; Förster, Wolfgang; Binotsch, Carolin; Awiszus, Birgit; Lampke, Thomas)
Comparative investigation of hydrogen embrittlement of palladium deposits from ionic liquid and aqueous electrolyte (Mehner, Thomas*; Nickel, Daniela; Nehrkorn, Sissy; Yulinova, Alexandra; Pügner, Marc; Scharf, Ingolf; Lanzinger, Gloria; Böck, Reinhard; Lampke, Thomas)
Co-deposition behavior of alumina nanoparticles and properties of Ni-Al2O3 nanocomposite coatings (Sadeghi, Amir*; Sieber, Maximilian; Scharf, Ingolf; Lampke, Thomas)
Separation of corrosion-affecting parameters of formed products - a new strategy using X-ray diffraction and corrosion tests under in-situ tensile load (Mehner, Thomas*; Bauer, Alexander; Nickel, Daniela; Binotsch, Carolin; Awiszus, Birgit; Lampke, Thomas)
Effect of Strain Localization on Pitting Corrosion of an AlMgSi0.5 Alloy (Nickel, Daniela; Dietrich, Dagmar*; Mehner, Thomas; Frint, Philipp; Spieler, Dagobert; Lampke, Thomas)
Influence of Particulate Reinforcement and Equal-Channel Angular Pressing on Fatigue Crack Growth of an Aluminium Alloy (Köhler, Lisa*; Hockauf, Kristin; Lampke, Thomas)
Novel Adhesion Promoter for Metal Plastic Composites (Yulinova, Alexandra*; Göring, Mandy; Nickel, Daniela; Spange, Stefan; Lampke, Thomas)
Interface Characterization and Bonding Mechanisms of Cold Gas-Sprayed Al Coatings on Ceramic Substrates (Drehmann, Rico*; Grund, Thomas; Lampke, Thomas; Wielage, Bernhard; Manygoats, K.; Schucknecht, T.; Rafaja, D.)
Elektrisch leitfähige kohlenstofffaserverstärkte Kunststoffe (CFK) mit freiliegender Funktionsschicht (Böttger-Hiller, Falko*; Jahn, P.; Trautmann, Maik; Lindner, Thomas; Nickel, Daniela; Lampke, Thomas)
Heat flux and temperature distribution in gear hobbing operations (Stark, Sibylle*; Beutner, Martin; Lorenz, Falk; Uhlmann, S.; Karpuschewski, Bernhard; Halle, Thorsten)
Effect of additive and current mode on surface morphology of palladium films from a non-aqueous deep eutectic solution (DES) (Böck, Reinhard*; Lanzinger, Gloria; Freudenberger, Renate; Mehner, Thomas*; Nickel, Daniela; Scharf, Ingolf; Lampke, Thomas)
Cyclic behavior and microstructural stability of ultrafine-grained AA6060 under strain-controlled fatigue (Hockauf, Kristin*; Niendorf, Thomas; Wagner, Swetlana; Halle, Thorsten; Meyer, Lothar Werner)
Schriftenreihe
- Band 1: 1. Werkstofftechnisches Kolloquium, 24./25.9. 1998 (nicht unter dieser ISSN erschienen)
- Band 2: 2. Werkstofftechnisches Kolloquium, 14./15.10. 1999
- Band 4: 3. Werkstofftechnisches Kolloquium, 19./20.10.2000
- Band 7: 4. Werkstofftechnisches Kolloquium OWT&WTK, 20./21.09.2001
- Band 11: 5. Werkstofftechnisches Kolloquium, 24./25.10.2002
- Band 16: 6. Werkstofftechnisches Kolloquium OWT&WTK, 25./26.09.2003
- Band 18: 7. Werkstofftechnisches Kolloquium 30.09./01.10.2004
- Band 22: 8. Werkstofftechnisches Kolloquium OWT&WTK, 29./30.09.2005
- Band 24: 9. Werkstofftechnisches Kolloquium, 07./08.09.2006
- Band 25: SFB 692 HALS "Hochfeste Aluminiumbasierte Leichtbauwerkstoffe für Sicherheitsbauteile" Tagungsband zum 1. Kolloquium, 26.09.2007
- Band 26: 10. Werkstofftechnisches Kolloquium OWT&WTK, 27./28.09.2007
- Band 31: 11. Werkstofftechnisches Kolloquium WTK, 02./03.10.2008
- Band 35: 8. Industriefachtagung "Oberflächen- und Wärmebehandlungstechnik" und 12. Werkstofftechnisches Kolloquium, 1./2.10.2009
- Band 37: 13. Werkstofftechnisches Kolloquium WTK, 30.09./01.10.2010
- Band 41: 18. Symposium Verbundwerkstoffe und Werkstoffverbunde in Chemnitz 2011
- Band 43: 14. Werkstofftechnisches Kolloquium und 9. Industriefachtagung Oberflächen- und Wärmebehandlungstechnik, 01.09./02.09.2011
- Band 47: 15. Werkstofftechnisches Kolloquium in Chemnitz 2012
- Band 50: 16. Werkstofftechnisches Kolloquium in Chemnitz 2013
- Band 52: 17. Werkstofftechnisches Kolloquium in Chemnitz 2014
- Band 59: Tagungsband, 18. Werkstofftechnisches Kolloquium (WTK), 2016
- Band 61: Tagungsband, 19. Werkstofftechnisches Kolloquium (WTK), 2017
- Band 72: Tagungsband 20. Werkstofftechnisches Kolloquium (WTK), 2018
- Band 82: Tagungsband 21. Werkstofftechnisches Kolloquium (WTK), 2019
- Band 91: Tagungsband 22. Werkstofftechnisches Kolloquium (WTK), 2021
- Band 13: Abschlussbericht, Kristin Trommer, Andreas Wank: Synthese von B-C-N Schichten aus flüssigen Ausgangsstoffen mittels DC Plasmajet CVD
- Band 17: Diplomarbeit, Grund, T.: Spritztechnische Applikation von Loten zum Fügen von Leichtmetallen
- Band 19: Diplomarbeit, Friesen, E.: Analyse des Zusammenhangs zwischen Mikrostruktur und tribologischen Eigenschaften thermisch gespritzter Verschleißschutzschichten
- Band 3: Dissertation, Klose, H.: Beitrag zur Berechnung, Herstellung und Charakterisierung von verstärkten Aktivloten
- Band 5: Dissertation, Azarava, T.: Entwicklung von Verbundpulvern auf der Basis von Titankarbid für das thermische Spritzen hochverschleißfester Schichten
- Band 6: Dissertation, Odeshi, A.G.: Beitrag zur Herstellung von kohlenstofffaserverstärkten Keramikmatrix-Verbunden
- Band 8: Dissertation, Schüler, H.: Simulation von Lötprozessen beim Metall-Keramik-Löten
- Band 9: Dissertation, Lampke, Th.: Beitrag zur Charakterisierung naturfaserverstärkter Verbundwerkstoffe mit hochpolymerer Matrix
- Band 10: Dissertation, Wank, A.: Hochratesynthese von Hartstoffschichten auf Siliciumbasis mittels thermischer Plasmen
- Band 12: Dissertation, Schnick, T. M.: Thermisches Spritzen von inkongruent schmelzenden Werkstoffsystemen auf der Basis von Silicium
- Band 14: Dissertation, Hahn, F.: Untersuchung des zyklisch plastischen Werkstoffverhaltens unter umformnahen Bedingungen
- Band 15: Dissertation, Reisel, G.: Oxidationsverhalten hochgeschwindigkeits-flammgespritzter Schichten auf Basis von Molybdänsiliziden
- Band 20: Dissertation, Schwenk, A.: Entwicklung und Erprobung neuartiger Düsen für das atmosphärische Plasmaspritzen
- Band 21: Dissertation, Mücklich, S.: Beitrag zum flussmittelfreien Löten von Magnesiumwerkstoffen mit angepassten Lotwerkstoffen
- Band 23: Dissertation, Hoyer, I. M.: Beitrag zur Entwicklung von Hochtemperaturloten auf Eisenbasis
- Band 27: Dissertation, Mucha, H.: Untersuchungen zur Porositätsentwicklung von Phenolharzen als Polymer- und Kohlenstoffspendermatrices in C-Faserverbundwerkstoffen
- Band 28: Dissertation, Rahm, J.: Herstellung langfaserverstärkter Aluminium-Matrix-Verbundwerkstoffe durch Anwendung der Prepregtechnik
- Band 32: Dissertation, Werner, A.: Thermische Stabilität von abriebfähigen Dichtungswerkstoffen auf Ni- oder Co-Basis für Hochdruckverdichter
- Band 33: Dissertation, Rupprecht, C.: Ganzheitliche Verfahrens- und Schichtoptimierung für das Hochgeschwindigkeitsdrahtflammspritzen
- Band 34: Dissertation, Nickel, D.: Gefüge- und Eigenschaftscharakterisierungen unbeschichteter grobkörniger und ultrafeinkörniger sowie anodisch oxidierter Aluminiumlegierungen
- Band 36: Dissertation, Hartmann, U.: Erhöhung der Verschleißfestigkeit von aktiven Werkzeugelementen und von Gleitringdichtungssystemen im elastomerverarbeitenden Maschinenbau durch Einsatz alternativer Werkstoffe und Technologien, 2009
- Band 38: Dissertation, Wözel, M.: Grundlegende Untersuchungen zum Verhalten von Verschleißschutzschichten bei Beanspruchung auf Ermüdungsverschleiß, 2010
- Band 39: Dissertation, Grund, T.: Applikation, Charakterisierung und Einsatz kaltgasgespritzter Kupfer-Nickel-Lotschichten für TiAl6V4-Substrate, 2010
- Band 40: Dissertation, Kim, Y.-E.: Modified Phenol-Formaldehyde Resins for C-Fiber Reinforced composites: Chemical Characteristics of Resins, Microstructure and Mechanical Properties of their Composites
- Band 42: Dissertation, Angermann, K.: Beitrag zur Entwicklung und Fertigung einer lokalen und beanspruchungsgerechten Verstärkung für hochfeste Aluminiumbauteile
- Band 44: Dissertation, Hockauf, K.: Ermüdungs- und Rissfortschrittsverhalten ausscheidungshärtbarer ultrafeinkörniger Aluminiumlegierungen
- Band 45: Dissertation, Weis, S.: Beitrag zur Entwicklung partikelverstärkter Weich- und Weichaktivlote zum Fügen temperaturempfindlicher Aluminiummatrix-Verbundwerkstoffe
- Band 46: Dissertation, Ommer, M.: Korrelation zwischen Herstellverfahren, Gefüge und Eigenschaften lichtbogenbelasteter Silber-Metalloxid-Kontaktwerkstoffe
- Band 49: Dissertation, Jung, H.: Neuartige dispersionsverstärkte Kontaktwerkstoffe auf Silber-Basis
- Band 51: Dissertation, Özer, I.: Legierungstechnische und tribologische Entwicklung von Bremsscheiben aus sprühkompaktierten Aluminium-Matrixkompositen
- Band 53: Dissertation: Mäder, T.: Neuartige Sensoren zur Erfassung von Dehnungen in Faserverbundwerkstoffen (Structural Health Monitoring)
- Band 54: Dissertation: Merklinger, V.: Beitrag zur Entwicklung einer niedrigschmelzenden Legierung und deren Applikation zum Korrosionsschutz hochfester Stahlsorten
- Band 55: Dissertation: Frint, P.: Lokalisierungsphänomene nach kombinierter hochgradig plastischer Umformung durch Extrusion und ECAP einer 6000er-Aluminiumlegierung
- Band 56: Dissertation, Hausner, S.: Potential von Nanosuspensionen zum Fügen bei niedrigen Temperaturen, 2015
- Band 57: Dissertation, König, J.: Auslegung eines optimierten Lichtbogendrahtspritzprozesses für Zylinderlaufbahnen von Verbrennungsmotoren, 2016
- Band 58: Dissertation, Pelic, B.: Nanoscale surface engineering for improved corrosion resistance of CuZn, PbSn and TiAl alloys, 2016
- Band 60: Dissertation, Roder, K.: Matrix- und Interfacedesign bei faserverstärkter Keramik hergestellt im Flüssigsilicierverfahren, 2016
- Band 62: Dissertation, Özdeniz, E. A.: Entwicklung korrosions- und verschleißbeständigerthermisch gespritzter Zylinderlaufbahnen für Verbrennungsmotoren, 2016
- Band 63: Dissertation, Sieber, M.: Elektrochemisches Modell zur Beschreibung der Konversion von Aluminium durch anodische Oxidation, 2016
- Band 64: Dissertation, Meyer, D.: Korrelation zwischen Herstellungsprozess, Struktur und Eigenschaften von anodischen Aluminiumoxidschichten für Verschleißschutz- Anwendungen, 2017
- Band 65: Dissertation, Mehner, T.: Zusammenhänge zwischen Werkstoff- und Oberflächenzustand und der Korrosionsanfälligkeit von Metallen, 2017
- Band 66: Dissertation, Zillmann, B.: Fließspannungsermittlung an Feinblechen unter ebener biaxialer Druckbelastung, 2017
- Band 67: Dissertation, Fritsch, S.: Einfluss von Tieftemperaturumformungen auf das Werkstoffverhalten einer hochfesten AlZnMgCu-Legierung, 2017
- Band 68: Dissertation, Drehmann, R.: Haftmechanismen kaltgasgespritzter Aluminiumschichten auf keramischen Oberflächen, 2017
- Band 69: Dissertation, Todt, A.: Beitrag zur Entwicklung neuartiger hybrider Werkstoffverbunde auf Polymer/Keramik-Basis, 2017
- Band 70: Dissertation Winter, S.: Mikrostrukturelle Einflussparameter auf die adiabatische Scherbandbildung in einer metastabilen ß-Titanlegierung, 2017
- Band 71: Dissertation Härtel, M.: Werkstoffmechanischer und mikrostruktureller Vergleich von uniaxialen und biaxialen Bauschinger-Effekten im Blechwerkstoff DC06, 2017
- Band 73: Dissertation Siebeck, S.: Pulvermetallurgische Synthese von Aluminiummatrix-Verbundwerkstoffen durch Hochenergiemahlen, 2018
- Band 74: Dissertation Elibol, C.: Lokalisierungs- und Relaxationsphänomene in pseudoelastischen und martensitischen NiTi-FGL
- Band 75: Dissertation Winkler, R.: Haftmechanismen von Metallen (Cu, Al) appliziert durch Draht-Lichtbogenspritzen auf Polymeroberflächen (PEEK), 2018
- Band 76: Dissertation Uhlig, T.: Neuartige Co-Basislote zum Hochtemperaturlöten thermisch stark belasteter Bauteile, 2018
- Band 77: Dissertation, Streb, F.: Novel materials for heat dissipation in semiconductor technologies, 2018
- Band 78: Dissertation, Lindner, T.: Verfahrenskombination zur Randschichthärtung thermisch gespritzter Schichtsysteme aus austenitischem Stahl, 2018
- Band 79: Dissertation, El-Araby Megahed Ali, I.: Oxidationsverhalten von Wärmedammschichtsystemen mit Al-Zwischenschichten, 2018
- Band 81: Dissertation, Pfeiffer, S.: Mikromechanische Modellbildung und FE-Simulationen zur elastischen Anisotropie von verzwillingten NiTi-Martensiten, 2019
- Band 83: Dissertation, Morgenstern, R.: Anodische Oxidation von kupferhaltigen Aluminiumlegierungen, 2019
- Band 84: Dissertation, Blank, R.: Entwicklung von HT-Lötsystemen für artfremde Werkstoffverbunde, 2019
- Band 85: Dissertation Trautmann, M.: Beschichtung von Kohlenstoffeinzelfasern für die Funktionalisierung von Faser-Kunststoff-Verbunden, 2019
- Band 86: Dissertation, Gießmann, M.: Finite element modeling of complex stress states and tension/compression asymmetry in NiTi shape memory alloys, 2020
- Band 87: Dissertation, Winter, L.: Schwingfestigkeit und Mittelspannungsempfindlichkeit der Legierung AlMgSi1 nach hochgradig plastischer Umformung und anodischer bzw. plasma-elektrolytischer Oxidation, 2020
- Band 88: Dissertation, Landgraf, P.: Gefüge- und Härteentwicklung bei der Laserstrahlbehandlung von hochlegierten Werkzeugstählen, 2020
- Band 89: Dissertation Engel, W.: Mikrostruktureller Einfluss auf die adiabatische Scherbehandlung in einem hochfesten Stahl, 2021
- Band 90: Dissertation Löbel, M.: Einfluss der Struktur und Herstellungsroute auf das tribologische Verhalten thermisch gespritzter Hochentropielegierungen, 2021
- Band 92: Dissertation Thomä, M.: Wirkung von Leistungsultraschall auf das Prozessverhalten und die Bindungsmechanismen beim Rührreibschweißen von Aluminium/Stahl-Verbunden, 2021
- Band 29: Habilitation, Mücklich, S.: Leichtbaupotenziale durch Einsatz von Leichtmetallen
- Band 30: Habilitation, Lampke, Th.: Gestaltung technischer Oberflächen mit funktionalen Aufgaben
- Band 48: Habilitation, Nickel, D.: Ausgewählte Eigenschaften und Charakterisierungsmethoden von biodegradierbaren und archäologischen metallbasierten Werkstoffen
- Band 80: Habilitation, Hansal, W.: Elektrochemische Pulsabscheidung, 2018
Presse und Medien
Professur Werkstoff- und Oberflächentechnik
Ausschnitt aus der Sendung "auto mobil" (VOX) vom 06.12.2015
Menschzentrierte Digitalisierung in der Produktion (Abteilung HCPS)
YouTube-Videos mit Bezug zum Maschinenbau (TU Chemnitz)
Merge – Forschungsprojekt (TU Chemnitz)
Weitere Videos
Dieser Bereich wird fortlaufend aktualisiert. Weitere Videos folgen.