
Inhalt Hotkeys
Fakultät für Maschinenbau

Verteidigte Promotionen an der Fakultät für Maschinenbau, chronologisch, seit 2003

2018-07-10 Regel, Joachim
Bewertung konstruktiver und kompensatorischer Maßnahmen zur thermo-sensitiven Auslegung von Werkzeugmaschinenstrukturen
Betreuer: Prof. Neugebauer
2018-07-03 Streb, Fabian
Novel materials for heat dissipation in semiconductor technologies
Betreuer: Prof. Lampke
2018-06-29 Heinrich, Michael
In-situ-Prozesse zur Kontaktierung und Verbindung piezokeramischer Module neuer Generation
Betreuer: Prof. Kroll
2018-06-21 Keller, Carsten
Verfahren zur automatisierten Shim-Maß-Berechnung am Beispiel von Karosseriebauspannvorrichtungen
Betreuer: Prof. Putz
2018-06-20 Parodi, Jaime Alejandro Puentes
Adhesion of Polyurethane-Steel Hybrids and Influence of Annealing on its Durability and Lifetime
Betreuer: Prof. Gehde
2018-05-04 Maenz, Torsten
Spritzgießtechnische Herstellung duroplastgebundener Dauermagnete
Betreuer: Prof. Gehde
2018-04-19 Regensburger, Jochen
Nichtlineares Deformationsverhalten von Karosserie-Außenhautbauteilen aus Aluminium im Lacktrocknungsprozess (online verfügbar)
Betreuer: Prof. Drossel
2018-04-16 Meichsner, Gunnar
Entwicklung und Realisierung einer Methode zur Bestimmung von Prozesseingangsgrößen für das elektrochemische Präzisionsabtragen
Betreuer: Prof. Schubert
2018-04-13 Strobel, Jens
Untersuchung von Schwingungen an einem Stetigfördersystem mit Kunststoffgleitketten (online verfügbar)
Betreuer: Prof. Nendel
2018-03-28 Findeisen, Fabian
Radiale Diffusoren in Warmwasserspeichern - Einfluss des Beladesystems auf Strömungsverhalten und Schichtungsqualität (online verfügbar)
Betreuer: Prof. Platzer
2018-03-27 Uhlig, Thomas
Neuartige Co-Basislote zum Hochtemperaturlöten thermisch stark belasteter Bauteile (online verfügbar)
Betreuer: Prof. Wagner, G.
2018-03-16 Tästensen, Robert
Integrierte Methode zur objektiven Bewertung von Equipmentfehlern in der Instandhaltung und rationellen Investitionsplanung (SEAFIP) (online verfügbar)
Betreuer: Prof. Müller
2018-02-23 Winkler, Ruben
Haftmechanismen von Metallen (Cu, Al) appliziert durch Draht-Lichtbogenspritzen auf Polymeroberflächen (PEEK) (online verfügbar)
Betreuer: Prof. Lampke
2018-02-23 Hartung, Ingmar
Fahrzeugnahe Methoden zur Diagnose von Degradationsvorgängen an automobilen PEM-Brennstoffzellen-Aggregaten (online verfügbar)
Betreuer: Prof. von Unwerth
2018-02-20 Elibol, Cagatay
Lokalisierungs- und Relaxationsphänomene in pseudoelastischen und martensitischen NiTi-Formgedächtnislegierungen (online verfügbar)
Betreuer: Prof. Wagner
2018-02-12 Simon, Katharina
Erfassung des subjektiven Erlebens jünger und älterer Autofahrer zur Ableitung von Unterstützungsbedürfnissen im Fahralltag
Betreuer: 231231
2018-01-24 Siebeck, Steve
Pulvermetallurgische Synthese von Aluminiummatrix-Verbundwerkstoffen durch Hochenergiemahlen (online verfügbar)
Betreuer: Prof. Wagner, G.
2018-01-22 Qin, Renhang
Dynamische Simulation des Verhaltens von Gasen in Heizungsanlagen (online verfügbar)
Betreuer: Prof. Platzer
2018-01-19 Weiß, Frederik
Methodik zur optimalen Konzeptauslegung elektrifizierter Fahrzeugantriebe (online verfügbar)
Betreuer: Prof. von Unwerth
2017-12-20 Wächter, Michael
Engineering-Methode zur Gestaltung gebrauchstauglicher tangibler Mensch-Maschine-Schnittstellen für Planer und Entwickler von Produktionsassistenzsystemen (online verfügbar)
Betreuer: Prof. Bullinger-Hoffmann
2017-12-18 Kaiser, André
Modellierung maximaler menschlicher Muskelmomente auf Basis digitaler Menschmodelle - am Beispiel der oberen Extremitäten (online verfügbar)
Betreuer: Prof. Bullinger-Hoffmann
2017-12-04 Ringleb, Ansgar
Numerische und experimentelle Untersuchung der fluiddynamischen Eigenschaften von Strahlströmungen in begrenzten Räumen (online verfügbar)
Betreuer: Prof. Wozniak
2017-11-21 Kleicke, Roland
Analyse und Optimierung der Webtechnik zur Realisierung von textilen Halbzeugen mit gestreckten Fadenlagen für die Faserverbundwerkstoffe (online verfügbar)
Betreuer: Prof. Cebulla
2017-11-16 Winter, Sven
Mikrostrukturelle Einflussparameter auf die adiabatische Scherbandbildung in einer metastabilen ?-Titanlegierung
Betreuer: Prof. Wagner
2017-11-13 Steinert, Philipp
Fertigung und Bewertung deterministischer Oberflächenmikrostrukturen zur Beeinflussung des tribologischen Verhaltens von Stahl-Bronze-Gleitpaarungen (online verfügbar)
Betreuer: Prof. Schubert
2017-11-02 Härtel, Markus
Werkstoffmechanischer und mikrostruktureller Vergleich von uniaxialen und biaxialen Bauschinger-Effekten im Blechwerkstoff DC06im Blechwerkstoff DC06 (online verfügbar)
Betreuer: Prof. Wagner, M.
2017-10-20 Rosen, Philipp
Beitrag zur thermischen und geometrischen Optimierung von Wasserstoffdruckbehältern für die automobile Anwendung (online verfügbar)
Betreuer: Prof. von Unvwerth
2017-10-12 Bräunig, Jan
Entwicklung und Verifizierung eines Berechnungsmodells zur Anregungsprognose von Verzahnungen unter Berücksichtigung des anisotropen Materialverhaltens (online verfügbar)
Betreuer: Prof. Neugebauer
2017-10-10 Dietz, Ronald
Strukturbezogene Betrachtung zum Zeitstandverhalten geschweißter Polyolefinhalbzeuge - Morphologie und Bruchverhalten (online verfügbar)
Betreuer: Prof. Gehde
2017-09-19 Dallinger, Niels
Die Diskrete Elemente Methode in der Vibrationsfördertechnik (online verfügbar)
Betreuer: Prof. Nendel
2017-09-18 Putzke, Enrico
Charakteristik und Verhalten von synthetischen Faserstoffen in homogenen und heterogenen Wirkpaarungen (online verfügbar)
Betreuer: Prof. Nendel
2017-09-12 Bartsch, Ralf
Erweiterung der Dimensionierungsgrundlagen für Gleitkettensysteme (online verfügbar)
Betreuer: Prof. Nendel
2017-09-11 Drehmann, Rico
Haftmechanismen kaltgasgespritzter Aluminiumschichten auf keramischen Oberflächen (online verfügbar)
Betreuer: Prof. Lampke
2017-09-08 Donner, Hendrik
FEM-basierte Modellierung von Hybridcorden und Hybridcord-Elastomer-Verbunden (online verfügbar)
Betreuer: Ihlemann
2017-09-05 Irmscher, Susann
Neues Programmmodell für das Pulsschweißen (online verfügbar)
Betreuer: Prof. Matthes
2017-08-24 Todt, Andreas
Beitrag zur Entwicklung neuartiger hybrider Werkstoffverbunde auf Keramik/Polymer-Basis (online verfügbar)
Betreuer: Prof.Wagner, G.
2017-08-09 Weil, Christoph
Technologische Wirkzusammenhänge des kontinuierlichen Widerstands-Pressschweißens mit umschließendem Induktor
Betreuer: Prof. Landgrebe
2017-08-07 Zillmann, Benjamin
Fließspannungsermittlung an Feinblechen unter ebener biaxialer Druckbelastung (online verfügbar)
Betreuer: Prof. Lampke
2017-07-20 Hielscher, Holger
Entwicklung einer Hochleistungsultraschalleinheit mit hohen Schwingungsamplituden (online verfügbar)
Betreuer: Prof. Neugebauer
2017-07-20 Hecht, Benjamin
Vorhersage und Bewertung der Qualitätskriterien rollgefalzter Karosserieanbauteile (online verfügbar)
Betreuer: Prof. Neugebauer
2017-07-17 Hoffmann, Uwe
Kennzahlenbasierte Entscheidungsunterstützung für die aggregierte Produktionsprogrammplanung (online verfügbar)
Betreuer: Prof. Müller
2017-06-22 Quade, Michael
Methodik zur Entwicklung eines Baukastens für wandlungsfähige Produktionsmittel
Betreuer: Prof. Müller
2017-06-12 Raschke, Kristin
Grundlagenuntersuchungen zur Prozess- und Struktursimulation von Phenolharzformmassen mit Kurz- und Langglasfaserverstärkung (online verfügbar)
Betreuer: Prof. Gehde
2017-06-09 Sowade, Enrico
Selbstorganisationsphänomene nanoskopischer Materialien im Inkjetdruck (online verfügbar)
Betreuer: Prof. Baumann
2017-06-08 Michna, Gregor
Planungsmodell für die montagegerechte Produktbeeinflussung in der Produktentstehungsphase eines Automobilherstellers (online verfügbar)
Betreuer: Prof. Müller
2017-06-07 Kaars, Jonny
Zur Thermomechanik des Widerstandspunktschweißens von Vergütungsstahl am Blechstoß mit Spalt (online verfügbar)
Betreuer: Prof. Mayr
2017-05-19 Hoppe, Thomas
Thermodynamische Analyse von Konzepten zur Energierückgewinnung aus Wasserstoffspeichern für PEM-Brennstoffzellensysteme (online verfügbar)
Betreuer: Prof. von Unwerth
2017-05-11 Mehner, Thomas
Zusammenhänge zwischen Werkstoff- und Oberflächenzustand und der Korrosionsanfälligkeit von Metallen (online verfügbar)
Betreuer: Prof. Lampke
2017-05-05 Küchler, Pierre
Fahrzeugnahe Kühlungsrandbedingungen von Abgassystemen an Motorprüfständen
Betreuer: Prof. Platzer
2017-05-05 Konarsky, Michael
Entwicklung eines IT-gestützten Kosteninformations-Systems als Instrument des Produktkostenmanagements in der Auftragsfertigung (online verfügbar)
Betreuer: Prof. Leidich
2017-04-28 Arnold, Roman
Entwicklung eines Modells zur Bewertung der Qualität der Digitalen Fabrik am Beispiel der Automobilindustrie (online verfügbar)
Betreuer: Prof. Müller
2017-04-21 Sacher, Patrick
Rückfederungsreduzierung durch simulationsbasierte Methodenoptimierung in der Blechumformung (online verfügbar)
Betreuer: Prof. Awiszus
2017-03-31 Meyer, Daniel
Korrelation zwischen Herstellungsprozess, Struktur und Eigenschaften von anodischen Aluminiumoxidschichten für Verschleißschutzanwendungen (online verfügbar)
Betreuer: Prof. Lampke
2017-02-23 Hipp, Kevin
Einsatz hybrider Optimierungsverfahren zur Inbetriebnahme elektromechanischer Systeme
Betreuer: Prof. Neugebauer
2017-02-20 Schulze, Karola
Adhäsions- und Degradationsverhalten an der Grenzfläche zwischen Titan und Polyetheretherketon (online verfügbar)
Betreuer: Prof. Wielage
2017-02-14 Ulke-Winter, Lars
Naturanaloge Optimierungsverfahren zur Auslegung von Faserverbundstrukturen (online verfügbar)
Betreuer: Prof. Kroll
2017-02-13 Krones, Manuela
A Method to Identify Energy Efficient Measures for Factory Systems Based on Qualitative Modeling (online verfügbar)
Betreuer: Prof. Müller
2017-01-26 Podlesak, Frank
Entwicklung und Verifizierung eines vorlochfreien mechanischen Fügeverfahrens zum Verbinden von Leichtmetallen und Faser-Kunststoff-Verbunden (online verfügbar)
Betreuer: Prof. Mayr
2017-01-18 Fritsch, Sebastian
Einfluss von Tieftemperaturumformungen auf das Werkstoffverhalten einer hochfesten AlZnMgCu-Legierung (online verfügbar)
Betreuer: Prof. Wagner, M.
2017-01-10 Jäckel, Mathias
Erweiterung der Prozessgrenzen für das Halbhohlstanznieten durch den Einsatz geteilter Matrizenwerkzeuge
Betreuer: Prof. Landgrebe
2016-12-21 Krauß, Alexander
Optimierte Sickengestaltung im Konstruktionsprozess dünnwandiger Bauteile (online verfügbar)
Betreuer: Prof. Leidich
2016-12-21 Sieber, Maximilian
Elektrochemisches Modell zur Beschreibung der Konversion von Aluminium durch anodische Oxidation (online verfügbar)
Betreuer: Prof. Lampke
2016-12-19 Krüger, David
Auslegungsgrenzen, Grübchen- und Zahnfußtragfähigkeit asymmetrischer Stirnradverzahnungen (online verfügbar)
Betreuer: Prof. Leidich
2016-12-16 Rautenstrauch, Anja
Methodik zur Prozessauslegung anforderungsgerecht gestalteter Strukturbauteile im Automobilbau (online verfügbar)
Betreuer: Prof. Neugebauer
2016-12-06 Vibrans, Tobias
Induktive Erwärmung von Formplatinen für die Warmumformung (online verfügbar)
Betreuer: Prof. Drossel
2016-11-11 Danzer, Christoph
Systematische Synthese, Variation, Simulation und Bewertung von Mehrgang- und Mehrantrieb-Systemen rein elektrischer und hybrider Fahrzeugantriebe (online verfügbar)
Betreuer: Prof. von Unwerth
2016-11-10 Gelbrich, Sandra
Funktionsintegrative Leichtbaustrukturen für Tragwerke im Bauwesen (online verfügbar)
Betreuer: Prof. Kroll
2016-11-02 Naumann, Christoph
Chemisch-mechanisch gekoppelte Modellierung und Simulation oxidativer Alterungsvorgänge in Gummibauteilen (online verfügbar)
Betreuer: Prof. Ihlemann
2016-10-26 Özdeniz, Eyüp Akin
Entwicklung korrosions- und verschleißbeständiger thermisch gespritzter Zylinderlaufbahnen für Verbrennungsmotoren (online verfügbar)
Betreuer: Prof. Lampke
2016-10-21 Siengchin, Suchart
Naturfaserverstärkte Thermoplaste (Natural Fiber Reinforced Thermplastics) (online verfügbar)
Betreuer: Prof. Kroll
2016-10-07 Kalinowska, Agnieszka
Wissenschaftlich-technischer Beitrag zum prozessintegrierten Bedrucken von Kunststoffteilen während des Spritzgießens
Betreuer: Prof. Gehde
2016-09-28 Sadeghi, Amir
Microstructure evolution and strengthening mechanism in Ni-based composite coatings (online verfügbar)
Betreuer: Prof. Lampke
2016-08-30 Alaluss, Khaled Ahmed
Modellbildung - Simulation des Plasma-Schweißens zur Entwicklung innovativer Schweißbrenner (online verfügbar)
Betreuer: Prof. Matthes
2016-08-19 Hofmann, Stefan
Untersuchungen zur Ermüdungsfestigkeit von Pressverbindungen (online verfügbar)
Betreuer: Prof. Leidich
2016-08-18 Gerstmann, Thoralf
Erweiterung der Verfahrensgrenzen desn Flach-Clinchens (online verfügbar)
Betreuer: Prof. Awiszus
2016-08-02 Kretschmer, Andreas
Einflussfaktoren auf die Lebensdauer laufender Faserseile
Betreuer: Prof. Nendel
2016-07-12 Pflugradt, Noah
Modellierung von Wasser- und energieverbräuchen in Haushalten (online verfügbar)
Betreuer: Prof. Platzer
2016-07-01 Müller, Sascha
Kerbfestigkeitsanalyse nietgefügter Faserverbund- und Metallkomponenten unter Berücksichtigung richtungsabhängiger lokaler Versagensmechansimen
Betreuer: Prof. Kroll
2016-07-01 Hammerschmidt, Jens
Inkjet-based manufacture and mechanical reinforsement of microsieves (Inkjekt-basierte Herstellung und mechanische Stabilisierung von Mikrosieben) (online verfügbar)
Betreuer: Prof. Baumann
2016-06-27 Schlutter, Ruben
Ermittlung von Korrekturfaktoren zur Verbesserung der Qualität des Druckes von Spritzgießsimulationen
Betreuer: Prof. Gehde
2016-05-20 Maaß, geb. Leck, Lena
Strategische Einbindung der Umformsimulation in die Entwicklungsprozesskette Karosserie (online verfügbar)
Betreuer: Prof. Awiszus
2016-05-20 Wulf, Hans
Modellierung und Simulation von Selbstorganisationsprozessen in belasteten technischen Gummiwerkstoffen (online verfügbar)
Betreuer: Prof. Ihlemann
2016-05-02 Lamprecht, Andreas
Energieprädiktion und Reichweitendarstellung durch Navigationsdaten im Kraftfahrzeug (online verfügbar)
Betreuer: Prof. Mayer
2016-04-29 Vidner, Jakub
Methode zur Bewertung der Ermüdungsfestigkeit von reibdauerbeanspruchten Systemen
Betreuer: Prof. Leidich
2016-04-22 Bleesen, Christoph
Neue Verfahrenstechnologien und funktionelle Oberflächen zur gezielten Manipulation der tribologischen Eigenschaften von Bauteilen aus Kunststoffen (online verfügbar)
Betreuer: Prof. Nendel
2016-04-08 Klauke, Rainer
Lebensdauervorhersage mehrachsig belasteter Elastomerbauteile unter besonderer Berücksichtigung rotierender Beanspruchungsrichtungen (online verfügbar)
Betreuer: Prof. Ihlemann
2016-04-01 Nestler, Matthias
Umformung metallbasierter Mehrschichtverbunde mit Sensor- und Aktorfunktionalität
Betreuer: Prof. Neugebauer
2016-03-31 Hensel, Sebastian
Numerisch-simulative Modellbildung für die Entwicklung von Technolgien zur Herstellung von Piezo-Metall-Verbunden und deren Charakterisierung
Betreuer: Prof. Neugebauer
2016-03-31 Rehm, Matthias
Analyse mechanisch gekoppelter, gegenläufig verfahrender Direktantriebe und ihre Einordnung mittels prozessorientierter Entwicklungsmethodik
Betreuer: Prof. Neugebauer
2016-03-24 Stock, Timo
Gestaltung energieeffizienter Wertschöpfungsketten mittels modifizierter Wertstromanalyse
Betreuer: Prof. Müller
2016-03-04 Denninger, Daniel
Prozessorientierte Synthesemethodik am Beispiel der neuartigen Verlegetechnik D-3F zum Überflechten mit drei Fadensystmen (online verfügbar)
Betreuer: Prof. Berger
2016-02-12 Holl, Kai
Beitrag zum Laserdurchstrahlschweißen von Kunststoffen in der Medizintechnik
Betreuer: Prof. Gehde
2016-01-29 Roder, Kristina
Matrix- und Interfacedesign bei faserverstärkter Keramik auf Basis des Flüssigsilicierverfahrens (online verfügbar)
Betreuer: Prof. Wielage
2016-01-15 Plorin, Daniel
Gestaltung und Evaluation eines Referenzmodells zur Realisierung von Lernfabriken im Objektbereich der Fabrikplanung und des Fabrikbetriebes
Betreuer: Prof. Müller
2015-12-16 Barthel, Tom
Prozessanalyse und effektive Gestaltung von Hochgeschwindigkeitsscherschneidproessen
Betreuer: Prof. Neugebauer
2015-12-16 Zillger, Tino
Ortsaufgelöste Untersuchung massengedruckter Polymersolarzellen auf flexiblem Substrat (online verfügbar)
Betreuer: Prof. Hübler
2015-12-16 Müller, Michael
Direktmontage von Pierzokeramik-Bauelementen in mikrostrukturierte Bleche
Betreuer: Prof. Neugebauer
2015-12-04 Reißmann, Jan
Beitrag zur Entwicklung einer verbesserten Berechnungsmethode für die Ermittlung der Zahnfußtragfähigkeit von Zylinderschneckengetrieben (online verfügbar)
Betreuer: Prof. Leidich
2015-11-27 Pelic, Bernadeta
Nanoscale surface engineering for improved corrosion resistance of TiAl, PbSn and CuZn alloys
Betreuer: Prof. Lampke
2015-11-23 Siegel, Frank
Tiefdruckverfahren zur Herstellung von Katalysatorschichten für (PEM) Brennstoffzellen (online verfügbar)
Betreuer: Prof. Baumann
2015-11-20 Hausner, Susann
Potential von Nanosuspensionen zum Fügen bei niedrigen Temperaturen (online verfügbar)
Betreuer: Prof. Wielage
2015-11-20 König, Johannes
Auslegung eines optimierten Lichtbogendrahtspitzprozesses für Zylinderlaufbahnen von Verbrennungsmotoren
Betreuer: Prof. Wielage
2015-11-20 Lätzer, Michael
Untersuchungen zum Füge- und Übertragungsverhalten torsionsbelasteter Stahl-Aluminium-Rändelpressverbindungen (online verfügbar)
Betreuer: Prof. Leidich
2015-11-06 Schellenberg, Dirk
Identifikation und Optimierung im Kontext technischer Anwendungen
Betreuer: Prof. Ihlemann
2015-11-02 Israel, Markus
Sensitivitäts- und Robustheitsanalyse beim Clinchen dicker Stahlbleche
Betreuer: Prof. Neugebauer
2015-10-30 Walther, Mario
Entwicklung und Evaluierung eines systematischen Vorgehens zur Erfassung von Aktionskräften in der Automobilproduktion (online verfügbar)
Betreuer: Prof. Bullinger-Hoffmann
2015-10-20 Landgraf, Ralf
Modellierung und Simulation der Aushärtung polymerer Werkstoffe (online verfügbar)
Betreuer: Prof. Ihlemann
2015-10-19 Schneebauer, Martin
Neue Kunststofftechnologien zur Herstellung hybrider Leichtbaustrukturen mit hoher Funktionsdichte
Betreuer: Prof. Kroll
2015-10-07 Müller, Christoph
Untersuchung von Holzwerkstoffen unter Schlagbelastung zur Beurteilung der Werkstoffeignung für den Maschinenbau (online verfügbar)
Betreuer: Prof. Nendel
2015-10-05 Elgert, Thomas
Entwicklung eines Vorgehensmodells zur Unterstützung der Implementierung betrieblicher Informationssysteme in der Automobilproduktion – unter besonderer Berücksichtigung der Arbeits- und Prozessorganisation
Betreuer: Prof. Müller
2015-09-30 Oppelt, Thomas
Modell zur Auslegung und Betriebsoptimierung von Nah- und Fernkältenetzen (online verfügbar)
Betreuer: Prof. Platzer
2015-09-29 Hackert-Oschätzchen, Matthias
Gestaltung von elektrochemischen Abtragsprozessen durch Multiphysiksimulation gezeigt an der Endformgebung von Mikrobohrungen
Betreuer: Prof. Schubert
2015-09-28 Moch, Robert
Methodik zur Auswahl und zum Einsatz von Koordinationsinstrumenten in Produktionsnetzen
Betreuer: Prof. Müller
2015-09-04 Huang, Weilin
Beitrag zum Kerbspannungsverhalten anisotrop verstärkter Mehrschichtverbunde unter Berücksichtigung hygrothermischer Einflüsse
Betreuer: Prof. Kroll
2015-08-19 Schulze, Robin
Methodik zur integrativen Funktionsbestimmung und Dimensionierung von Maschinen und Transportmitteln
Betreuer: Prof. Müller
2015-07-28 Fischer, Marko
Leitfaden für Anlaufmanagement im Automobilbau unter Berücksichtigung von Standortbestimmungen
Betreuer: Prof. Müller
2015-07-23 Englich, Sascha
Strukturbildung bei der Verarbeitung von glasfasergefüllten Phenolformaldehydformmassen (online verfügbar)
Betreuer: Prof. Gehde
2015-06-29 Trnovec, Bystrik
Experimentelle Untersuchungen zur Schichtbildung im Tiefdruck mittels hydrophobierter Druckform mit Applikationsbeispielen aus dem Bereich der gedruckten OPV (online verfügbar)
Betreuer: Prof. Hübler
2015-06-24 Asdonk, Matthias
Modell zur Darstellung der Schlüsselelemente und Mechanismen eines Führungssystems Shop Floor
Betreuer: Prof. Müller
2015-06-23 Hopf, Hendrik
Methodik zur Fabriksystemmodellierung im Kontext von Energie- und Ressourceneffizienz
Betreuer: Prof. Müller
2015-04-15 Langer, Tino
Ermittlung der Produktivität verketteter Produktionssysteme unter Nutzung erweiterter Produktdaten
Betreuer: Prof. Neugebauer
2015-04-15 Schützle, Wilhelm
Beitrag zur Prozesskettensimulation geschweißter Aluminium-Karosserieanbauteile
Betreuer: Prof. Neugebauer
2015-04-09 Dittrich, Frank
Instrumentarium zur Unterstützung der nutzerzentrierten Entwicklung in kleinen und mittleren Unternehmen am Beispiel betrieblicher Anwendungssoftware
Betreuer: Prof. Bullinger-Hoffmann
2015-03-27 Ebert, Falk
Serielle Modellierung ebener Band- und Koppelgetriebe zur domänenübergreifenden Gesamtsimulation von nichtlinearen Antriebssystemen (online verfügbar)
Betreuer: Prof. Berger
2015-03-16 Heine, Andreas
Ein Beitrag zur kennwertorientierten Entwicklung von kurvengesteuerter, ebener Schrittgetriebe (online verfügbar)
Betreuer: Prof. Berger
2015-03-03 Petraus, Bernd
Modellbasierte proaktive Kommunikationsanalyse anhand der Projektstruktur und -organisation
Betreuer: Prof. Müller
2015-02-26 Schwanitz, Stefan
Mechanische Simulation der Interaktion Sportler-Sportgerät (online verfügbar)
Betreuer: Prof. Odenwald
2015-02-19 Zinecker, Mike
Einsatz mikro- und mesostrukturierter Oberflächen zur Verbesserung des Wärmeübergangs bei der Siedekühlung
Betreuer: Prof. Schubert
2015-01-27 Jentsch, David
Wandlungsfähigkeit im Management produzierender Unternehmen
Betreuer: Prof. Müller
2015-01-08 Mammitzsch, Jens
Untersuchungen zum Einsatz von ultrahochmolekularen Polyethylenfasern in Seilen für die Fördertechnik (online verfügbar)
Betreuer: Prof. Nendel
2014-12-12 Emmrich, Jens
Ein Beitrag zum technologischen Konzept, zur Funktion und Berechnung hybrider Filterzyklone für die Partikelabscheidung aus Gasen (online verfügbar)
Betreuer: Prof. Wozniak
2014-12-11 Frint, Philipp
Lokalisierungsphänomene nach kombinierter hochgradig plastischer Umformung durch Extrusion und ECAP einer 6000er-Aluminiumlegierung
Betreuer: Prof. Lampke
2014-12-05 Liu, Yao
Heat transfer process between polymer and cavity wall during injection molding (online verfügbar)
Betreuer: Prof. Gehde
2014-12-04 Hoyer, Stefan
Neuartige Warmmahltechnologie zum Recycling von Elastomeren und Analyse prozessbedingter Eigenschaften
Betreuer: Prof. Kroll
2014-11-07 Eben, Johannes
Identifikation und Reduzierung realer Schwankungen durch praxistaugliche Prozessführungsmethoden beim Spritzgießen (online verfügbar)
Betreuer: Prof. Gehde
2014-11-04 Imgrund, Christian
Ganzheitliche Ansätze und Methoden zur nachhaltigen Nauplanung einer energieeffizienten Fabrik mit besonderem Schwerpunkt auf die Automobilmontage (online verfügbar)
Betreuer: Prof. Platzer
2014-11-03 Oehme, Daniel
Bausteinbasiertes Modell zur Integration von Projektplanung, Projektbearbeitung und Projektabschluss für Fabrikplanungsprojekte
Betreuer: Prof. Müller
2014-10-24 Hellmich, Arvid Sören
Nichtinvasive Identifikation von Regelstreckenparametern für elektromechanische Achsen
Betreuer: Prof. Neugebauer
2014-10-24 Glänzel, Janine
Korrektur thermoplastischer Verformungen durch den Einsatz der adaptiven FEM
Betreuer: Prof. Neugebauer
2014-10-23 Höer, Martin
Einfluss der Material- und Verarbeitungseigenschaften von Phenolharzformmassen auf die Qualität spritzgegossener Bauteile (online verfügbar)
Betreuer: Prof. Gehde
2014-10-17 Sommer, Oliver
Ein Beitrag zur Untersuchung des Verhaltens dünner Flüssigkeitsfilme nahe gekrümmten Substratoberflächen - Exp. Beschichtungsversuche und numerische Filmsimulation (online verfügbar)
Betreuer: Prof. Wozniak
2014-10-06 Bankwitz, Hagen
Simulation und Analyse ringgespannter Zahnriemengetriebe (online verfügbar)
Betreuer: Prof. Nendel
2014-09-25 Merklinger, Verena
Beitrag zur Entwicklung einer niedrigschmelzenden Legierung und deren Applikation zum Korrosionsschutz hochfester Stahlsorten
Betreuer: Prof. Wielage
2014-09-24 Weise, Sebastian
Entwicklung und Evaluation von Hochleistungsgleitketten aus Kunststoff
Betreuer: Prof. Nendel
2014-09-19 Grönke, Kerstin
Beitrag zur Optimierung der Verfahrensparameter von Vliesstoffausrüstungsprozessen bei hohen Warengeschwindigkeiten (online verfügbar)
Betreuer: Prof. Platzer
2014-08-22 Zwingenberger, Carsten
Beitrag zur Verbesserung der Simulationsgenauigkeit bei der Bestimmung des thermischen Verhaltens von Werkzeugmaschinen
Betreuer: Prof. Neugebauer
2014-08-04 Wonneberger, Kai-Uwe
Konzept zur Zielplanung für die Fabrikplanung mit unternehmenswertorientierter Ausrichtung
Betreuer: Prof. Müller
2014-07-03 Mäder, Thomas
Neuartige Sensoren zur Erfassung von Dehnungen in Faserverbundwerkstoffen (Structural Health Monitoring) (online verfügbar)
Betreuer: Prof. Wielage
2014-06-26 Friedrich, Sven
Lineares Vibrationsschweißen von Kunststoffen im industriellen Umfeld - Einflüsse und Restriktionen (online verfügbar)
Betreuer: Prof. Gehde
2014-06-23 Münnich, Mario
Strategische multikriterielle Standort- und Fabrikplanungsmethodik mittels szenariendifferenzierter und risikobasierter Produktrechnungen
Betreuer: Prof. Müller
2014-06-19 Kaufmann, Jörg
Beitrag zu anisotropiebedingten Koppeleffekten bei rotationssymmetrischen mehrschichtigen Faserverbundbauteilen
Betreuer: Prof. Kroll
2014-05-23 Feuerhack, Andreas
Experimentelle und numerische Untersuchungen von Al-Mg-Verbunden mittels Verbundschmieden (online verfügbar)
Betreuer: Prof. Awiszus
2014-05-09 Shutov, Alexey
Numerische Simulation des viskoplastischen Verhaltens metallischer Werkstoffe bei endlichen Deformationen14.11.2012 (online verfügbar)
Betreuer: Prof. Ihlemann
2014-04-04 Jentsch, Martin
Eignung von objektiven und subjektiven Daten im Fahrsimulator am Beispiel der aktiven Gefahrenbremsung – eine vergleichende Untersuchung (online verfügbar)
Betreuer: Prof. Spanner-Ulmer
2014-03-17 Hälsig, Andrè
Energetische Bilanzierung von Schutzgasschweißverfahren (online verfügbar)
Betreuer: Prof. Mayr
2014-03-10 Georgi, Wolf
Beitrag zum mechanischen Fügen von Metall-Kunststoff-Mischverbindungen (online verfügbar)
Betreuer: Prof. Matthes
2014-03-04 Kotik, Florian Max
Integration von Fertigungswissen in den digitalen Planungsprozess der Automobilindustrie
Betreuer: Prof. Müller
2014-03-04 Scherf, Christian
Entwicklung, Herstellung und Evaluation des Modularen Alterssimulationsanzugs eXtra(MAX) (online verfügbar)
Betreuer: Prof. Spanner-Ulmer
2014-02-27 Rutsch, Andreas
Methodik zur Gestaltung von Lagersystemen in globalen Distributionsnetzwerken für Multibranchenprodukte dargestellt am Beispiel der DKHS Holding, Schweiz
Betreuer: Prof. Müller
2014-02-10 Chen , Xiaoli
Beitrag zur Bewertung technologischer Innovationsfähigkeit sowie zur Entscheidungsunterstützung für Unternehmen in Innovationsnetzwerken
Betreuer: Prof. Müller
2014-02-05 Ebbinghaus, Michael
Untersuchung der Verarbeitungseigenschaften im MIG-und Laserlötprozess an Stahlblechen mit unterschiedlichem Festigkeitsverhalten (online verfügbar)
Betreuer: Prof. Matthes
2014-01-30 Schönherr, geb. Jendrusch, Ricardo
Simulationsbasierte Absicherung der Ergonomie mit Hilfe digital beschriebener menschlicher Bewegungen (online verfügbar)
Betreuer: Prof. Spanner- Ulmer
2014-01-29 Kleditzsch, Stefan
Beitrag zur Modellierung und Simulation von Zylinderdrückwalzprozessen mit elementaren Methoden (online verfügbar)
Betreuer: Prof. Awiszus
2014-01-24 Gansauge, Ludwig-Ingo
Methodik zur Industrialisierung der Einzelfertigung am Beispiel des Werkzeug- und Formenbaus
Betreuer: Prof. Müller
2014-01-14 Pinner, Sebastian
Untersuchung von Methoden zur durchgängigen Prozesskettensimulation im Karosseriebau
Betreuer: Prof. Awiszus
2013-12-18 Kick, Marco
Gebremste Laufwagensysteme für Schwerkrafthängeförderer im Rahmen einer nachhaltigen Low-Cost-Fördertechnik
Betreuer: Prof. Nendel
2013-12-09 Jakubik, Uwe
Effizienzermittlung von Maßnahmen mit Gwichtsauswirkung in der PkW-Entwicklung (online verfügbar)
Betreuer: Prof. Leidich
2013-12-02 Drechsler, Florian
Modulares Behältersystem für die Automobilindustrie, deren Zulieferer und Logistikdienstleister
Betreuer: Prof. Nendel
2013-11-13 Özer, Ihsan Ulas
Legierungstechnische und tribologische Entwicklung von Bremsscheiben aus Aluminium-Matrixkompositen
Betreuer: Prof. Lampke
2013-11-08 Truckenbrodt, Christian
Beitrag zur Entwicklung und Integration unterschiedlicher Methoden zur Online-Qualitätssicherung beim Laserstrahlschweißen von Aluminiumkehlnähten
Betreuer: Prof. Neugebauer
2013-11-06 Maurer, Thomas
Zur kosteneffizienten Herstellung von gewickelten Faserverbundwalzen unter Berücksichtigung der Methode der Lean Production (online verfügbar)
Betreuer: Prof. Kroll
2013-11-04 Nestler, Daisy
Beitrag zum Thema: Verbundwerkstoffe - Werkstoffverbunde - Status quo und Forschungsansätze (online verfügbar)
Betreuer: Prof. Wielage
2013-10-16 Teich, Tobias
Geschäftsprozessgetriebene Konfiguration wandlungsfähiger Gebäudeinfrastrukturen
Betreuer: Prof. Müller
2013-09-23 Lauterbach, Johannes Michael
Energie ScoreCard - Bewertungskriterien für Kraftwerke und ihre Relevanz aus Investorensicht
Betreuer: Prof. Platzer
2013-09-04 Zhang , Ran
Spanen thermoplastischer Kunststoffe mit vielschneidigen geometrischen nicht bestimmten Schneiden (Schleifen und Polieren)
Betreuer: Prof. Schubert
2013-08-16 Heinze, Thorsten
Zug- und biegewechselbeanspruchte Seilgeflechte aus hochfesten Polymerfasern
Betreuer: Prof. Nendel
2013-08-14 Krebs, Janine
Zum Einfluss der Werkzeugoberfläche auf die Entformbarkeit und die Oberflächenqualität von Spritzgießbauteilen
Betreuer: Prof. Kroll
2013-07-30 Gröger, Sophie
Funktionsgerechte Spezifikation geometrischer Eigenschaften mit dem System der Geometrischen Produktspezifikation und -verifikation (online verfügbar)
Betreuer: Prof. Dietzsch
2013-07-22 Vay, Henrik
Vorgehensmodell zum Projekt-Risikomanagement im Anlagenbau
Betreuer: Prof. Müller
2013-07-11 Maiwald, Andreas
Numerische Analyse des Wanderverhaltens von Wälzlagerringen
Betreuer: Prof. Leidich
2013-06-21 Bergmann, Markus
Verfahren zur Herstellung gradiert hochgradig plastisch umgeformter Werkstoffe
Betreuer: Prof. Neugebauer
2013-06-21 Dix, Martin
Ressourceneffizientes Hochleistungsbohren mit Spiralbohrern - Analyse und Prozessauslegung
Betreuer: Prof. Neugebauer
2013-06-19 Hübler, Jörg
Textilverstärkte Zugmittel für die Antriebs- und Fördertechnik mit formschlüssiger Krafteinleitung (online verfügbar)
Betreuer: Prof. Nendel
2013-06-04 Brückner, Karoline
Charakterisierung der mechanischen Eigenschaften von weichelastischen Schaumstoffen unter impulsartigen sportspezifischen Belastungen (online verfügbar)
Betreuer: Prof. Odenwald
2013-05-29 Weigelt, Karin
Integration gedruckter Elektronik in Kunststoffe durch Folienhinterspritzen (online verfügbar)
Betreuer: Prof. Hübler
2013-05-08 Clauß, Michael
Methode zum Einsatz von Web 2.0-Werkzeugen in der Fabrikplanung (online verfügbar)
Betreuer: Prof. Müller
2013-05-03 Klimant, Philipp
Virtual Reality gestützte Kinematik- und Materialabtragssimulation für Fräsmaschinen mittels Hardware-in-the-Loop
Betreuer: Prof. Neugebauer
2013-05-03 Kräusel , Verena
Gestaltung und Bewertung einhubiger Scherschneidverfahren mit starren Werkzeugen unter besonderer Berücksichtigung der Schnittflächenqualität an Blechbauteilen
Betreuer: Prof. Neugebauer
2013-05-02 Bester, Alwyn
Entwicklung von alternativen Erwärmungsmethoden für Mangan-Bor-Stähle
Betreuer: Prof. Neugebauer
2013-04-11 Schönherr, Micaela
Entwicklung und Implementierung produktbezogener Dienstleistungen in der Werkzeugmaschinenindustrie
Betreuer: Prof. Neugebauer
2013-03-26 Dombeck, Uwe
Beitrag zur Dimensionierung von Fördersystemen mit Staurollenketten (online verfügbar)
Betreuer: Prof. Nendel
2013-03-15 Winkler, Sebastian
Generierung von Teilarbeitsgängen im Rahmen eines durchgängigen Ansatzes zur automatischen Arbeitsplanerstellung
Betreuer: Prof. Müller
2013-03-12 Schade, Klaus Peter
Experimentelle Untersuchungen des Einflusses der Wandrauigkeit auf Rückprallgeschwindigkeit und Partikelrotation kleiner Partikel beim Aufprall auf feste Wände
Betreuer: Prof. Wozniak
2013-03-04 Philipp, Klaus
Kosteneffiziente Leichtbaustrukturen für denPkw-Innenraum mit hochwertigen funktionellen Oberflächen
Betreuer: Prof. Kroll
2013-02-28 Härtig, Thomas
Stoffübertragung beim Spritzgießen (online verfügbar)
Betreuer: Prof. Gehde
2013-02-20 Helbig, geb. Speck, Markus
Methoden zur Bestimmung der Ablegereife an hochfesten Kunstfaserseilen
Betreuer: Prof. Nendel
2013-02-20 Seidlitz, Holger
Entwicklung von kraftflussgerechten Verbindungstechniken für Mischbauweisen mit thermoplastischen Faserverbunden und Metallen
Betreuer: Prof. Kroll
2013-02-20 Löser, Carsten
Präzises Schneiden schwer zu bearbeitender Materialien durch Wasserabrasivinjektorstrahlen mit verringertem Strahldurchmesser
Betreuer: Prof. Dürr
2013-02-15 Freund, Michael
Verallgemeinerung eindimensionaler Materialmodelle für die Finite-Elemente-Methode
Betreuer: Prof. Ihlemann
2013-02-07 Härtel, Sebastian
Experimentelle und numerische Untersuchungen zur Verfahrensentwicklung des Unrunddrückens (online verfügbar)
Betreuer: Prof. Awiszus
2013-01-28 Li , Lei
Synergetische Planungsmethodik für Industrieparks
Betreuer: Prof. Müller
2013-01-25 Fuhrich, René
Infrarotschweißen von Kunststoffen mit thermischen Strahlungsemittern
Betreuer: Prof. Gehde
2013-01-24 Heuß, Hans-Peter
Qualifikation als Innovationsfaktor am Beispiel der externen Promotion
Betreuer: Prof. Spanner-Ulmer
2013-01-15 Ponton, Philipp Manuel
Methodik zur Abwicklung von Produktionsverlagerungen
Betreuer: Prof. Müller
2013-01-09 Rohrmus, Dominik
Adaptive invariante Merkmale für die Texturklassifikation
Betreuer: Prof. Awiszus
2013-01-08 Waltl, Hubert
Selbstoptimierung der Einarbeit von Karosseriewerkzeugen durch werkzeugintegrierte Aktorik
Betreuer: Prof. Neugebauer
2012-12-20 Buschmann, Markus
Planung und Betrieb von Energiedatenerfassungssystemen
Betreuer: Prof. Müller
2012-12-19 Eichhorn, Sven
Berechnungsansatz für Strukturbauteile aus Holzfurnierlagenverbundwerkstoff-WVC (online verfügbar)
Betreuer: Prof. Nendel
2012-12-19 Eckardt, Ronny
Untersuchungen an Verbindungselementen für Holzkonstruktionen im Maschinen- und Anlagenbau (online verfügbar)
Betreuer: Prof. Nendel
2012-12-14 Nestler, Andreas
Erzeugung definierter Oberflächeneigenschaften bei der Drehbearbeitung von partikelverstärkten Aluminiummatrix-Verbundwerkstoffen
Betreuer: Prof. Schubert
2012-12-13 Jung, geb.Steger, Heike
Neuartige dispersionsverstärkte Kontaktwerkstoffe auf Silber-Basis
Betreuer: Prof. Wielage
2012-12-12 Göppert , Stefan
Fluidstrahlen - Erzeugung, Strömungsfeld und Wärmeübergang
Betreuer: Prof. Platzer
2012-12-03 Kausch, Martin
Entwicklung hochbelasteter Leichtbaustrukturen aus lasergenerierten metallischen Komponenten mit Faserverbundverstärkung
Betreuer: Prof. Kroll
2012-11-29 Leesch, Mirko
Beitrag zur systematischen Synthese und Bewertung von Doppelkupplungsgetrieben
Betreuer: Prof. Tenberge
2012-11-29 Rupprecht , Christian
Moderne Methoden und Anwendungen des Thermischen Spritzens (online verfügbar)
Betreuer: Prof. Wielage
2012-11-29 Nickel , Daniela
Ausgewählte Eigenschaften und Charakterisierungsmethoden von biodegradierbaren und archäologischen metallbasierten Werkstoffen
Betreuer: Prof. Lampke
2012-11-16 Krauß, Andreas
Zustandsgeregelte dynamische Dimensionierung von Produktionssystemen im Kontext des Produktionsmanagements (online verfügbar)
Betreuer: Prof. Müller
2012-11-02 Riedel, Ralph
Systemische Fabrikplanung auf Basis eines kybernetisch-soziotechnischen Modells
Betreuer: Prof. Müller
2012-11-01 Scholz, Sebastian
Epoxidharzbasierte Nanokomposit-Schichten für mechanisch, tribologisch und medial belastete Faser-Kunststoff-Verbunde
Betreuer: Prof. Kroll
2012-10-26 Hermann, Jörn
Kennzahlbasierte Planungsmethode zur Optimierung der Anlagennutzung von Großteilpressen
Betreuer: Prof. Neugebauer
2012-10-19 Herrle, Tobias
Entwicklung und Erprobung eines Online-Lackmischverfahrens für die Automobilserienlackierung
Betreuer: Prof. Wozniak
2012-10-05 Richter, Markus
Virtual Reality-unterstützte Optimierung des dynamischen Verhaltens von Werkzeugmaschinen
Betreuer: Prof. Neugebauer
2012-10-04 Kuprin, geb. Gahlert, Corinna
Verformungsverfestigung bei zyklisch inkrementeller Torsion von Reineisen und dem Stahl 42CrMo4N (online verfügbar)
Betreuer: Prof. Wagner
2012-09-26 Mainda, Patrick Michael
Piezoelektrische Aktoren in Presswerkzeugen zur Beeinflussung des Umformprozesses
Betreuer: Prof. Neugebauer
2012-09-25 Hofmann, Stefan
Identifikation parametrischer Modelle für geregelte, elektromechanische Achsen mit modifizierter sukzessiver Polkompensationan mechatronischen Achsen
Betreuer: Prof. Neugebauer
2012-09-05 Tröltzsch, Jürgen
Spritzgießtechnische Direktimprägnierung textiler Halbzeuge und Preformen bei komplexen Hochleistungsbauteilen
Betreuer: Prof. Kroll
2012-08-24 Ihlenfeldt, Steffen
Redundante Werkzeugmaschinenstruktur für die Komplettbearbeitung im Großwerkzeugbau - Modellbasierter Systementwurf und Prototyp
Betreuer: Prof. Neugebauer
2012-07-30 Neukirchner, Heiko
Wirkungsgrade und dynamisches Verhalten von Ventilsteuerungen mit pneumatischer Ventilfeder
Betreuer: Prof. Tenberge
2012-07-30 Endres, Martin
Entwicklung einer aktiven Steuerung für die geometrischen Qualitätsziele der Prozesskette Karosseriebau
Betreuer: Prof. Dietzsch
2012-07-18 Rasch, Frank
Reibungsminderung an Stütz- und Führungselementen für Kunststoffketten
Betreuer: Prof. Nendel
2012-07-12 Darwich , Samer
Corrosion protection concepts for aluminium and magnesium alloys coated with silicate films prepared by water-based-sol-gel process (online verfügbar)
Betreuer: Prof. Lampke
2012-07-12 Edelmann, Jan
Mikrostrukturierung von Flachglas durch Heißprägen
Betreuer: Prof.Schubert
2012-06-29 Petersen, Udo
Beitrag zum Übertragungsverhalten von rechteckförmigen Mehrschraubenverbindungen (MV)
Betreuer: Prof. Leidich
2012-06-29 Lehmann, Thomas
Experimentell-numerische Analyse mechanischer Eigenschaften von Aluminium/Magnesium-Werkstoffverbunden
Betreuer: Prof. Ihlemann/Dr. Stockmann
2012-06-28 Jander, Henning
Entwicklung einer Methode zur produktbasierten Reduzierung der Zeitspreizung in der Automobilmontage
Betreuer: Prof. Spanner- Ulmer
2012-06-22 Kolouch, Martin
Simulation des Einflusses der Gelenke auf das statische und dynamische Verhalten von parallelkinematischen Werkzeugmaschinen
Betreuer: Prof. Neugebauer
2012-06-21 Schönherr, Ruben
Regelkreisüberwachung mechatronischer Antriebssysteme
Betreuer: Prof. Neugebauer
2012-06-20 Wetzel, Tommy
Magnesiumblech-Technologiekette für innovative Leichtbauanwendungen im Automobilbau
Betreuer: Prof. Neugebauer
2012-06-12 Kranz, Burkhard
Beitrag zur numerischen Beschreibung des funktionellen Verhaltens von Piezoverbundmodulen (online verfügbar)
Betreuer: Prof. Neugebauer
2012-05-31 Eckert, Alexander
Prognose der Maßhaltigkeit punktförmig mechanisch gefügter Karosseriebauteile
Betreuer: Prof. Neugebauer
2012-05-22 Reuter, Kay
Elektrostatische Aufladung von organischen Feldeffekttransistoren zur Verbesserung einfacher gedruckter Schaltungen (online verfügbar)
Betreuer: Prof. Hübler
2012-05-16 Dreves, Frank
Empirische Studie von Werkmechanismen zum Wandel in der Arbeitswelt am Beispiel Ergonomie, Demographie und Führung
Betreuer: Prof. Spanner-Ulmer
2012-05-11 Kittner, Kai
Integrativer Modellansatz bei der Co-Extrusion von Aluminium-Magnesium-Verbunden (online verfügbar)
Betreuer: Prof. Awiszus
2012-04-20 Deckert, Matthias H.
Beitrag zur Entwicklung eines hochdynamischen variothermen Temperiersystems für Spritzgießwerkzeuge (online verfügbar)
Betreuer: Prof. Kroll
2012-03-27 Badra, Hashem
Entwicklung eines Navigators für die Fertigungssimulation
Betreuer: Prof. Müller
2012-03-20 Weis, Sebastian
Beitrag zur Entwicklung partikelverstärkter Weich- und Weichaktivlote zum Fügen temperaturempfindlicher Aluminiummatrix-Verbundwerkstoffe (online verfügbar)
Betreuer: Prof. Wielage
2012-03-16 Stocek, Radek
Zur dynamischen Rissausbreitung von Elastomerwerkstoffen (online verfügbar)
Betreuer: Prof. Gehde
2012-03-07 Mühlstedt, Jens
Entwicklung eines Modells dynamisch-muskulärer Arbeitsbeanspruchungen auf Basis digitaler Menschmodelle (online verfügbar)
Betreuer: Prof. Spanner-Ulmer
2012-02-22 Ommer, Matthias
Korrelation zwischen Herstellverfahren, Gefüge und Eigenschaften lichtbogenbelasteter Silber-Metalloxid-Kontaktwerkstoffe (online verfügbar)
Betreuer: Prof. Wielage
2012-02-09 Zeidler, Henning
Schwingungsunterstützte Mikro-Funkenerosion
Betreuer: Prof. Schubert
2012-02-08 Billig, Susan
Abbau von Polyethylenterephthalat mit PET-Hydrolasen aus Thermobifida fusca KW3 (online verfügbar)
Betreuer: Prof. Platzer; Prof. Zimmermann
2012-02-08 Müller, Jörg
Beitrag zur systematischen, rechnergestützten Synthese und Bewertung mehrgängiger konventioneller und hybrider Planetenautomatikgetriebe
Betreuer: Prof. Tenberge
2012-01-31 Tran , Ngoc Anh
Featurebasierte Entscheidungsmethodik zur Bewertung alternativer technologischer Prozessketten in der Teilefertigung
Betreuer: Prof. Dürr
2012-01-23 Beyer, Ulrike
Multi-Flach-Fügen mittels Flach-Clinch-Technologie
Betreuer: Prof. Awiszus
2011-12-22 Rinberg, Roman
Technologieentwicklung zur Herstellung von naturfaserverstärkten Bauteilen in Leichtbauweise unter Einsatz von Ganzpflanzenrohstoffen
Betreuer: Prof. Kroll
2011-12-16 Jahn, Stephan Felix
Möglichkeiten und Herausforderungen des Funktionsdrucks mittels Inkjettechnologie, gezeigt an zwer Anwendungsbeispielen
Betreuer: Prof. Baumann
2011-12-15 Kienzle, Florian
Fertigungssteuerung in der Musterfertigung von Systemlieferanten (online verfügbar)
Betreuer: Prof. Müller
2011-12-14 Schob, Uwe
Methode zur frühen virtuellen Inbetriebnahme von Steuerungsprogrammen durch halbautomatische Maschinenmodellbildung
Betreuer: Prof. Neugebauer
2011-11-22 Glühmann, Jan
Verschleißmechanismen und Leistungspotenziale stickstoffgesinterter Gradientenhartmetalle für die Zerspanung
Betreuer: Prof. Dürr
2011-11-21 Hubrig, Marko
Methode zur integrativen kostenorientierten Produktionssystemplanung im Kontext der digitalen Fabrik
Betreuer: Prof. Müller
2011-11-15 Urbaneck, Thorsten
Kältespeicher - Grundlagen, Technik, Anwendung
Betreuer: Prof. Platzer
2011-10-17 Schmidt, Georg
Oberflächenspannungstrukturiertes Drucken zur Herstellung polymerelektronischer Bauteile
Betreuer: Prof. Hübler
2011-09-30 Sittiho, Mutchima
Qualitative Beurteilung des Gaseintrages in thermische Energieversorgungssysteme auf Grund der Gaspermeation (online verfügbar)
Betreuer: Prof. Platzer
2011-09-21 Bartzsch, Matthias
Herstellung von Schottky-Dioden mittels Rolle-zu-Rolle-Verfahren
Betreuer: Prof. Hübler
2011-08-30 Hensel-Unger, Ralph
Entwicklung einer Gestaltungssystematik für das Industrial Engineering unter besonderer Berücksichtigung kultureller Einflussfaktoren am Beispiel von Tschechien und Polen
Betreuer: Spanner-Ulmer
2011-08-26 Keil, Mathias
Entwicklung eines arbeitswissenschaftlichen Modellansatzes für die nachhaltige Implementierung von Produktionssystemen in Unternehmen
Betreuer: Spanner-Ulmer
2011-07-29 Chodora, Marco
SALUCONTROL - Nutzen-Aufwand-Kalkulation von Maßnahmen im betrieblichen Gesundheitsmanagement mit Support des Controllings
Betreuer: Prof. Spanner-Ulmer
2011-07-29 Enderlein, Heiko
Flexible Analyse- und Bewertungs-Systematik zur Gestaltung nachhaltig effektiver, effizienter und menschgerechter Arbeit in indirekten Bereichen am Beispiel eines Automobilherstellers
Betreuer: Prof. Spanner-Ulmer
2011-07-26 Hockauf, Kristin
Ermüdungs- und Rissfortschrittsverhalten ausscheidungshärtbarer ultrafeinkörniger Aluminimlegierungen (online verfügbar)
Betreuer: Prof. Lampke
2011-07-22 Kern, Colin
Untersuchung des Betriebsverhaltens von Mehrflächengleitlagern mit Kunststofflaufschicht
Betreuer: Prof. Leidich
2011-05-20 Meißner, Christian
Entwicklung von Getriebesystemen zur aktiven Drehmomentenverteilung für Fahrzeuganwendungen
Betreuer: Prof. Tenberge
2011-04-08 Steinbach, Hendrik
Verfahren zur thermischen und mechanischen Auslegung von zyklisch arbeitenden Radialstromapparaten
Betreuer: Prof. Platzer
2011-03-14 Michael, Markus
Beitrag zur Treibfähigkeit von hochfesten synthetischen Faserseilen (online verfügbar)
Betreuer: Prof. Nendel
2011-03-14 Angermann, Kay
Beitrag zur Entwicklung und Fertigung einer lokalen und beanspruchungsrechten Verstärkung für hochfeste Aluminiumbauteile
Betreuer: Prof. Wielage
2011-03-03 Schneider, Thomas
Automatisierte Akquisition von erfahrungsbasiertem Fertigungswissen im Werkzeug- und Formenbau
Betreuer: Prof. Dürr
2011-02-24 Risch, Thomas
Zweidimensionale Bewegungsformen in der Vibrationstechnik
Betreuer: Prof. Nendel
2011-02-17 Ebert, Lars
Beeinflussung von geschweißten Auftragschichten durch instationäre Gasströme im Plasma-Pulver-Schweißprozess (online verfügbar)
Betreuer: Prof. Matthes
2011-01-28 Hädrich, Katrin
Ermittlungen und Untersuchungen zum Stirnfräsen typischer duro- und thermoplastischer Kunststoffe
Betreuer: Prof. Dürr
2010-12-17 Mejia Ambriz, Alejandro
Produktinnovation durch Kompetenzclusterbildung in kompetenzzellenbasierten Netzen (online verfügbar)
Betreuer: Prof. Neugebauer
2010-12-16 Mayer, Michael
Modellierung des statischen und dynamischen Materialverhaltens langfaserverstärkter Kunststoffe
Betreuer: Prof. Meyer
2010-12-14 Kuhl, Michael
Beitrag zur Qualitätsbewertung von Laserschweißnähten im Karosseriebau durch multivariate Datenanalyse von Sensorsignalen aus Pre-, In- und Postprozessmessverfahren
Betreuer: Prof. Neugebauer
2010-11-26 Kim , Young Eun
Modified Phenol-Formaldehyde Resins for C-Fiber Reinforces Composites: Chemical Characteristics of Resind, Microstructure and Mechanical Properties of their Composites (online verfügbar)
Betreuer: Prof. Wielage
2010-11-12 Lomachenko, Olga
Beiträge zum Einsatz solar unterstützter Systeme zur Beheizung von Industriegebäuden im Bestand
Betreuer: Prof. Platzer
2010-11-02 Faust, Karsten
Neue polymere Werkstoffkonzepte für Fördergleitketten und Systemanalyse der Korrelation von Reibungskoeffizienten
Betreuer: Prof. Nendel
2010-11-01 Leiber, Paul
Ergonomische Produktgestaltung am Beispiel mobiler Geräte im interkulturellen Vergleich: China-Deutschland-USA (online verfügbar)
Betreuer: Prof. Spanner-Ulmer
2010-10-26 King Kordi, Amal
Methodik zur bausteinbasierten Planung und Organisation von verfahrenstechnischen Produktionssystemen
Betreuer: Prof. Müller
2010-10-21 Merz, Ludger
New dynamic approach of a Safety Barrier Wall for a Civil Transport Aircraft
Betreuer: Prof. Kreißig
2010-10-13 Weigert, Philipp
Berücksichtigung formänderungsbedingter Effekte (Rückfederung) im Entwicklungsprozess der Methodenplanung von tiefgezogenen Karosseriebauteilen
Betreuer: Prof. Neugebauer
2010-10-05 Neumann, Norbert
Nutzenbasierte Bewertung und Optimierung von externen Wertschöpfungsstrukturen in der Automobilzulieferindustrie
Betreuer: Prof. Müller
2010-09-16 Wagner, Ulf
Standardisierung der Projektabwicklung im kundenspezifischen Maschinen- und Anlagenbau
Betreuer: Prof. Müller
2010-09-10 Hegner, Claus
Modellbasierte Vernetzung strategischer und operativer Anlaufgrößen von interdependenten Fahrzeugprojekten
Betreuer: Prof. Müller
2010-09-08 Nachtwey, Alexander
Methodischer Beitrag zur Betriebsanalyse komplexer Produktionssysteme
Betreuer: Prof. Müller
2010-06-17 Sritragool , Kunlapaporn
Modification of rubber particle filled thermoplastics with electrons during polymer processing or after molding
Betreuer: Prof. Gehde
2010-06-15 Laue, Martin
Methodik zur humanorientierten Systementwicklung und Kommunikationsoptimierung
Betreuer: Prof. Müller
2010-06-04 Baumgart, Rico
Reduzierung des Kraftstoffverbrauches durch Optimierung von Pkw-Klimaanlagen
Betreuer: Prof. Tenberge
2010-06-03 Simon, Marc
Entwicklung eines ganzheitlichen globalen Projektmanagement Systems unter besonderer Berücksichtigung interkultureller Unterschiede
Betreuer: Prof. Müller
2010-04-20 Lindner, Mario
Ermittlung der plastischen Anfangsanisotropie durch Eindringversuche (online verfügbar)
Betreuer: Prof. Kreißig
2010-03-31 Grund, Thomas
Applikation, Charakterisierung und Einsatz kaltgasgespritzter Kupfer-Nickel-Lotschichten für TiAl 6 V 4-Substrate
Betreuer: Prof. Wielage
2010-03-26 Pursche, Frank
Spezifizierung des Versagensverhaltens von Werkstoffen bei Druck-Scher-Belastung
Betreuer: Prof. Meyer
2010-03-10 Lohse, Rolf
Einfluss von Beladeeinrichtungen auf die thermische Schichtung in Warmwasserspeichern
Betreuer: Prof. Platzer
2009-12-15 Wözel, Margit
Grundlegende Untersuchungen zum Verhalten von Verschleißschutzschichten bei Beanspruchung auf Ermüdungsverschleiß
Betreuer: Prof. Wielage
2009-12-14 Hartmann, Uwe
Erhöhung der Verschleißfestigkeit von aktiven Werkzeugelementen und von Gleitringdichtsystemen im elastomerverarbeitenden Maschinenbau durch Einsatz alternativer Werkstoffe und Technologien
Betreuer: Prof. Wielage
2009-12-14 Halle , Thorsten
Ermittlung und Modellierung von Werkstoffkenndaten metallischer Werkstoffe bei hohen Dehnungsgeschwindigkeiten auf dem Fachgebiet: Werkstofftechnik/Werkstoffprüfung
Betreuer: Prof. Meyer
2009-11-25 Hackert, Matthias
Entwicklung und Simulation eines Verfahrens zum elektrochemischen Abtragen von Mikrogeometrien mit geschlossenem elektrolytischen Freistrahl
Betreuer: Prof. Schubert
2009-11-19 Ecorchard, Gael
Static Accuracy Enhancement of Redundantly Actuated Parallel Kinematic Machine Tools (online verfügbar)
Betreuer: Prof. Neugebauer
2009-10-15 Winkler, Anders
Experimentelle und theoretische Untersuchungen zur kunststoffgerechten Auslegung von Zahnrädern
Betreuer: Prof. Leidich
2009-08-06 Fiebig, Siegfried
Wandel zur flexiblen Fabrik - Konsequenzen für die Steuer- und Fördertechnik
Betreuer: Prof. Nendel
2009-07-16 Reuter, Susann
Untersuchung von Entwicklungs- und Transferprozessen beim flüssigtonerbasierten ferroelektrischen Druckverfahren (online verfügbar)
Betreuer: Prof. Hübler
2009-07-10 Hockauf, Matthias
Fließspannungsverhalten ultrafeinkörniger Aluminiumwerkstoffe unter besonderer Berücksichtigung der Dehnrate
Betreuer: Prof. Meyer
2009-07-07 Khaddour , Mounib
Negativbaufbau im Rollenoffsetdruck (online verfügbar)
Betreuer: Prof. Beier
2009-06-10 Böttcher, Sebastian
Beitrag zur Planung stückzahlflexibler Fertigungssysteme
Betreuer: Prof. Müller
2009-05-26 Nickel, Daniela
Gefüge- und Eigenschaftscharakterisierungen unbeschichteter grobkörniger und ultrafeinkörniger sowie anodisch oxidierter Aluminiumlegierungen
Betreuer: Prof. Wielage
2009-05-15 Nebel, Silvio
Ein Beitrag zur experimentellen und numerischen Analyse zeitabhängiger Eigenschaften von DMS-Messstellen
Betreuer: Prof. Naumann
2009-05-08 Mischke, Michael
Multimodale Bedienkonzepte im Dualtask - ein Ansatz für komplexe Bedienaufgaben im Fahrzeug
Betreuer: Prof. Spanner-Ulmer
2009-04-29 Ebert, Andreas
Berücksichtigung der elastischen Werkzeugdeformation im Bereich der Massivumformung am Beispiel Gesenkschmieden
Betreuer: Prof. Awiszus
2009-04-17 Wießner, Sven
Kontinuierliche Herstellung von Legierungen aus Elastomerpartikeln und Polypropylen durch reaktive Aufbereitung in einem Gleichdralldoppelschneckenextruder (online verfügbar)
Betreuer: Prof. Mennig
2009-04-14 Lehmann, Maik
Entwicklung einer Methodik zur Gestaltung von handlungsleitenden Informationsprozessen in Fertigungsabläufen der variantenreichen Großserienfertigung
Betreuer: Prof. Müller
2009-03-27 Opitz, Andreas
Methodik zur Planung ganzheitlich prozesseffizienter Fertigungssysteme
Betreuer: Prof. Müller
2009-03-06 Hänel, Thomas
Technologieentwicklung für die Herstellung patientenindividueller Knochenaufbauimplantate aus Beta-Tricalciumphosphat durch 3D-Printing
Betreuer: Prof. Dürr
2009-03-05 Bahn, Volker
Implementierung der Mehrpunkt-Technologie in den Innenhochdruck-Blechumformprozess (IHB)
Betreuer: Prof. Neugebauer
2009-03-02 Rupprecht, Christian
Ganzheitliche Verfahrens- und Schichtoptimierung für das Hochgeschwindigkeitsdrahtflammspritzen (online verfügbar)
Betreuer: Prof. Wielage
2009-02-17 Dietrich, Axel Maximilian
Gestaltung intra-organisationaler Produktionsnetzwerke - Methodik zur Konfiguration und Bewertung unternehmensinterner Produktionsnetzwerke mit standortübergreifender Kooperation zwischen Entwicklung und Produktion
Betreuer: Prof. Müller
2009-02-11 Schlegel, Gert
Experimentelle Untersuchungen zu Farbfilmbildungsprozessen in Sprühfarbwerken von Offsetdruckmaschinen (online verfügbar)
Betreuer: Prof. Hübler
2009-02-05 Bolick, Susanne
Integration von Prozessketten und Workflowmodellierung in PDM-Systemen
Betreuer: Prof. Awiszus
2009-02-03 Höinghaus, Lars
Entwicklung einer Simulationsmethodik zur Optimierung des Kühlschmierstoffeinsatzes bei mehrstufigen Warmumformprozessen
Betreuer: Prof. Awiszus
2009-01-26 Mokhtar , Mohd Noriznan
Biocatalytic Production, Preparation and Characterization of Large-Ring Cyclodextrins (online verfügbar)
Betreuer: Prof. Platzer/ Prof. Zimmermann
2009-01-16 Leischnig, Steffen
Entwicklung standardisierter Abläufe zur Verbesserung der Prozesszuverlässigkeit von Fertigungsanlagen (online verfügbar)
Betreuer: Prof. Müller
2009-01-09 Fischer, Thomas
Erzeugung leitfähiger Strukturen auf benetzungsstrukturierten Polymeroberflächen
Betreuer: Prof. Hübler
2008-12-15 Heintz, Steffen
Kooperationskultur projektbezogener Unternehmenskooperationen in KMU - Ein Beitrag zur Entwicklung eines Gestaltungsansatzes
Betreuer: Prof. Müller
2008-12-05 Baum, Heiko
Morphologie der Kooperation als Grundlage für das Konzept der Zwei-Ebenen-Kooperation
Betreuer: Prof. Müller
2008-12-04 Engelmann, Jörg
Methoden und Werkzeuge zur Planung und Gestaltung energieeffizienter Fabriken
Betreuer: Prof. Müller
2008-11-28 Schwörer, Falko
Methodik zur Vernetzung geographisch verteilter Forschungs- und Entwicklungstendenzen
Betreuer: Prof. Müller
2008-11-06 Werner, André
Thermische Stabilität von abriebfähigen Ddichtungswerkstoffen auf Nickel- oder Kobaltbasis für Hochdruckverdichter
Betreuer: Prof. Wielage
2008-10-23 Schulz, Bertram
Hochgenaue Lagezuordnung von Mikrobauteilen durch greiferintegrierte Winkelfeinstellungen (online verfügbar)
Betreuer: Prof. Neugebauer
2008-10-17 Gleich, Sven
Simulation des thermischen Verhaltens spanender Werkzeugmaschinen in der Entwurfsphase
Betreuer: Prof. Neugebauer
2008-09-18 Lehmann, Jens
Entwicklung von Methoden für Fabrikplanungsprozesse unter Nutzung von Werkzeugen der Digitalen Fabrik
Betreuer: Prof. Müller
2008-09-17 Kaiser, Michael
Mehrkriterielle Adaption multimedialer Prozessbeschreibungen für den Fabrikbetrieb mittels wissensbasierter Planungssysteme
Betreuer: Prof. Müller
2008-09-12 Thurner, Stefan
Erzeugung und Anwendung modulierter Prozessgasströme beim Schutzgasschweißen (online verfügbar)
Betreuer: Prof. Matthes
2008-08-29 Herzig, Norman
Beitrag zur Erfassung und Beschreibung des skalierten Fließ.-Verfestigungs- und Versagensverhalten ausgewählter metallischer Werkstoffe in einem weiten Bereich von Dehngeschwindigkeiten und Temperaturen (online verfügbar)
Betreuer: Prof. Meyer
2008-08-27 Binotsch, Carolin
Modellierung und Simulation des KRM- Planetenschrägwalzprozesses
Betreuer: Prof. Awiszus
2008-08-14 Mitzschke, Frank
Eigenschaftsprofile neuartiger faserverstärkter Kunststoffgleitketten für den Stückguttransport
Betreuer: Prof. Nendel
2008-08-11 Linke, Thomas
Ein Beitrag zur Dimensionierung des Schüttgutaustrages mittels Umschlagrad
Betreuer: Prof. Nendel
2008-07-24 Henze, Lars
Entwicklung einer Methode zum Aufdecken von potentiellen Fehlern in der Konstruktion (online verfügbar)
Betreuer: Prof. Dietzsch
2008-07-17 Gerlach, Marco
Erfassungsstrategie zur Ermittlung des Paarungsmaßes an zylindrischen Oberflächen für die mechanische Antastung (online verfügbar)
Betreuer: Prof. Dietzsch
2008-07-11 Walther, Volkhard
Grundlagen des Übertragungsverhaltens zentralverschraubter Stirnpressverbindungen
Betreuer: Prof. Leidich
2008-06-18 Hanke, Markus
Methodik zur Bewertung des thermo-mechanischen Verhaltens von komplexen kubischen Aluminiumwerkstücken bei der Trockenbearbeitung
Betreuer: Prof. Dürr
2008-06-06 Seifert, Michael
Temperiertes Innenhochdruck-Umformen von Rohren aus Magnesium- und Aluminiumlegierungen (online verfügbar)
Betreuer: Prof. Neugebauer
2008-06-05 Kaden, Hendrik
Beitrag zum Reibungs- und Verschleißverhalten von Zahnriemenförderern (online verfügbar)
Betreuer: Prof. Nendel
2008-06-03 Cho , Sang Hyun
Auswirkung von Nichtidealitäten auf den Ablauf von Folgereaktionen in Rohrraktoren (online verfügbar)
Betreuer: Prof. Platzer
2008-05-26 Schütze, Jens
Grundlagen und Ansätze zur Modellierung von Kommunikationsprozessen in KMU-Netzwerken
Betreuer: Prof. Müller
2008-05-26 Mücklich , Silke
Leichtbaupotenziale durch Einsatz von Leichtmetallen Fachgebiet: Werkstofftechnik (online verfügbar)
Betreuer: Prof. Wielage
2008-05-26 Lampke , Thomas
Gestaltung techn.Oberflächen mit funktionalen AufgabenFG: Werkstofftechnik und Oberflächentechnik
Betreuer: Prof. Wielage
2008-05-14 Einhaus, Marco
Beitrag zur Verbesserung des Sicherheitsstandards bei seilunterstützten Arbeitsverfahren im internationalen Vergleich
Betreuer: Prof. Spanner- Ulmer
2008-05-13 Gelbrich, Sandra
Beitrag zur Entwicklung von Krafteinleitungselementen für hochbeanspruchte Faserverbund-Zugstreben im Bauwesen
Betreuer: Prof. Kroll
2008-05-07 Horbach, Sebastian
Modulares Planungskonzept für Logistikstrukturen und Produktionsstätten kompetenzzellenbasierter Netze
Betreuer: Prof. Müller
2008-04-30 Raupach, Annett
Ergonomische Gestaltung multimedialer Arbeitsmittel
Betreuer: Prof. Spanner-Ulmer/Prof. Enderlein
2008-03-12 Tran , Thanh Ngoc
Limit and Shakedown Analysis of Plates and Shells Including Uncertainties (online verfügbar)
Betreuer: Prof. Kreißig
2008-03-07 Reinstettel, Marc
Laboruntersuchung zur Prozessstabilität beim Niet-Clinchen (online verfügbar)
Betreuer: Prof. Neugebauer
2008-02-20 Enge, Holger
Methodische Ansätze zur Verbesserung der Integration des Service in den Produktlebenszyklus von Automobilen
Betreuer: Prof. Müller
2008-02-19 Reiche, Michael
Referenzmodellierung technologischer Hauptprozesse der grafischen Industrie (online verfügbar)
Betreuer: Prof. Hübler
2008-02-15 Koca, Matthias
Untersuchungen zur Temperaturabhängigkeit des Formänderungsvermögens unter Beachtung des hydrostatischen Spannungszustandes
Betreuer: Prof. Naumann
2008-02-14 Gieschen, Katja
Kaizenorientierte Ablauforganisation am Beispiel schlanker Montagesysteme
Betreuer: Prof. Müller
2008-02-11 Rahm, Jens
Herstellung langfaserverstärkter Aluminium-Matrix-Verbundwerkstoffe durch Anwendung der Prepregtechnik (online verfügbar)
Betreuer: Prof. Wielage
2008-02-07 Stanková, Hana
Einfluss der inkrementellen Deformationen bei der thermomechanischen Behandlung auf die Eigenschaften von TRIP Stählen (online verfügbar)
Betreuer: Prof. Meyer
2007-12-14 Gerber, Anna
Methode zur Konzeption eines unternehmerspezifischen Qualitätsinformationssystems für kleinere Unternehmen (online verfügbar)
Betreuer: Prof. Dietzsch
2007-12-13 Schumann, Mathias
Zur Bestimmung der Umschlagleistung von Hochregallagern unter besonderer Berücksichtigung der Lagerorganisation (online verfügbar)
Betreuer: Prof. Nendel
2007-12-06 Hensel, Sven
Modellierung und Optimierung von Werkzeugmaschinen mit parallelkinematischen Strukturen
Betreuer: Prof. Neugebauer
2007-12-03 Krüger, Wilfried
Theoretische und empirische Beiträge zur Fabrikplanung unter dem Aspekt des demografischen Wandels
Betreuer: Prof. Müller
2007-11-30 Schmiedl, Nadja
Methodik zur prozessorientierten Restrukturierung von Arbeitssystemen
Betreuer: Prof. Spanner-Ulmer
2007-11-12 Ortmann, Sebastian
Herstellung von Blechdurchzügen (Kragen) in IHU-Bauteilen mit Hilfe von flüssigem Druckmedium
Betreuer: Prof. Neugebauer
2007-10-24 Matz, Detlef
Methode der logistischen Werkstruktur-Überplanung für Anlagen zur Herstellung von Fließgütern
Betreuer: Prof. Wirth
2007-09-05 Ackermann, Jörg
Modellierung, Planung und Gestaltung der Logistikstrukturen kompetenzzellenbasierter Netze (online verfügbar)
Betreuer: Prof. Müller
2007-08-07 Gumpoltsberger, Gerhard
Systematische Synthese und Bewertung von mehrgängigen Planetengetrieben
Betreuer: Prof. Tenberge
2007-07-25 Schröder, Thomas
Entwicklung und Evaluation von Algorithmen zur zeitoptimierten Bewegungszerlegung bei kinematisch redundanten Werkzeugmaschinen
Betreuer: Prof. Neugebauer
2007-07-17 Herold, Katrin
Entwicklung von standardisierten Prozessbausteinen für seilunterstützte Rettungs- und Bergeprozesse (online verfügbar)
Betreuer: Prof. Spanner-Ulmer
2007-07-13 Wucherer, Marc
Beitrag zur produktionstechnischen Gestaltung in Niedriglohnländern dargelegt am Fallbeispiel einer Elektronikproduktion in China
Betreuer: Prof. Müller
2007-07-05 Gröger, Sophie
Beitrag zum ganzheitlichen Bewerten von geometrischen Strukturen mit Tastschnittgeräten bis in den Nanometerbereich (online verfügbar)
Betreuer: Prof. Dietzsch
2007-06-26 Kondapalli , Satyanarayana
Oberflächenmodifikation von Aluminium-Bauteilen durch Entwicklung von Verbundbeschichtungen mit Hilfe des Plasma-Pulver-Auftragschweißprozesses
Betreuer: Dr.-Ing.habil. F. Riedel
2007-06-15 Wilhelm, Gerald
Quantitative Optimierung des Energieeintrags beim MSG-Hochleistungsschweißen nichtrostender Stähle
Betreuer: Prof. Matthes
2007-05-18 Weiß, Jörg
Modellbildung und Simulation radial gekoppelter Rotoren (online verfügbar)
Betreuer: Prof. Dresig
2007-04-27 Khadjavi (m), Armin Fazlollah
Ein Beitrag zur statischen Aeroelastik des Windkraftanlagenrotorblattes (online verfügbar)
Betreuer: Prof. Wozniak
2007-04-26 Näser, Peggy
Methode zur Entwicklung und kontinuierlichen Verbesserung des Anlaufmanagements komplexer Montagesysteme
Betreuer: Prof. Müller
2007-04-24 Mucha, Herbert
Untersuchungen zur Porositätsentwicklung von Phenolharzen als polymere Kohlenstoffspendermatrices in C-Faserverbundwerkstoffen
Betreuer: Prof. Wielage
2007-04-23 Ehrenheim, Christoph
Produktions- und Prozessoptimierung mit Hilfe von Kennzahlensystemen
Betreuer: Prof. Müller
2007-01-24 Shalaby, Hemdan
On the potential of large eddy simulation to simulate cyclone separators (online verfügbar)
Betreuer: Prof. Wozniak
2007-01-19 Roth, Stefan
Spritzgegossene Abschirmgehäuse aus stahlfasergefüllten Thermoplasten - Materialeigenschaften, Verarbeitung und Gestaltung (online verfügbar)
Betreuer: Prof. Mennig
2007-01-09 Wittstock, Volker
Piezobasierte Aktor-Sensor-Einheiten zur uniaxialen Schwingungskompensation in Antriebssträngen von Werkzeugmaschinen
Betreuer: Prof. Neugebauer
2006-12-18 Löschmann, Frank
Anlagentechnische Grundlagen für die Elektromagnetumformung im Automobilbau
Betreuer: Prof. Neugebauer
2006-12-12 Dietrich, Stephan
Grundlagenuntersuchungen zu neuen matrizenlosen Umformfügeverfahren
Betreuer: Prof. Neugebauer
2006-12-11 Ecke, Ramona
Abscheidung (CVD) und Charakterisierung W-basierter Diffusionsbarrieren für die Kupfermetallisierung
Betreuer: Prof. Wielage
2006-12-01 Forbrig, Frank
Untersuchungen zur Gestaltfestigkeit von Passfederverbindungen
Betreuer: Prof. Leidich
2006-11-28 Klaffert, Thomas
Selbstoptimierende HSC-Motorspindel
Betreuer: Prof. Neugebauer
2006-11-24 Liepack, Otfrid
Anwendung des Systems Engineering zur Verbesserung des Betriebes von planetaren Missionen
Betreuer: Prof. Müller
2006-11-17 Steiner, Ralf
Kompetenzzellenbasierte Produktentwicklung (online verfügbar)
Betreuer: Prof. Neugebauer
2006-10-24 Martens, Knut
Werkzeugwechselkonzepte für Bearbeitungszentren mit kurzer Werkzeugeingriffszeit
Betreuer: Prof. Neugebauer
2006-10-13 Thiele, Reiko
Untersuchungen zur Zahnfußbeanspruchung von Schneckenrädern und Entwicklung eines Tragfähigkeitsnachweises auf der Basis der Zahnfußschädigungshypothese
Betreuer: Prof. Leidich
2006-09-29 Patcharaphun (m), Somjate
Characterization and Simulation of Material Distributation and Fiber Orientation in Sandwich Injection Molded Parts
Betreuer: Prof. Mennig
2006-08-16 Banik (m), Kaushik
Prozessinduziertes Langzeitdeformationsverhalten von spritzgegossenen teilkristallinen Kunststoffen
Betreuer: Prof. Mennig
2006-07-20 Manuelli, Alessandro
Influences of printing techniques on the electrical performances of conjugated polymers for organic transistors
Betreuer: Prof. Hübler
2006-07-06 Ufer, René
Modellierung und Simulation von Drückwalzprozessen
Betreuer: Prof. Awiszus
2006-07-03 Li (m), Bincheng
Analyse und Simulation des Transversalschwingungseinflusses von Riemengetrieben auf Fehler der Werkstückoberfläche
Betreuer: Prof. Neugebauer
2006-06-23 Seitz, Bernhard
Optimierung der technischen Unternehmensführung mittels gewichteter Kennzahlen für klein- und mittelständische Unternehmen der Lackindustrie
Betreuer: Prof. Müller
2006-06-23 Panhans, Sonja
Ein viskoplastisches Materialmodell mit nichtquadratischer Fließfunktion
Betreuer: Prof. Kreißig
2006-06-08 Gäbel, Kai
Beitrag zur Inbetriebnahme von Antrieben mechatronischer Produktionsmaschinen als internetbasierte Dienstleistung
Betreuer: Prof. Heß
2006-05-29 Helbig, Frank
Gestaltungsmerkmale und mechanische Eigenschaften druckelastischer Abstandsgewirke
Betreuer: Prof. Köhler
2006-04-27 Shawky (m), Abdel Malek
Verformungs- und Versagensverhalten ausgewählter niedrig legierter Stähle unter Variation von Temperatur, Verformungsgeschwindigkeit und Spannungszustand
Betreuer: Prof. Meyer
2006-04-12 Brunotte, René
Die thermodynamischen und verfahrenstechnischen Abläufe der in-situ-Oberflächenmodifizierung beim Spritzgießen
Betreuer: Prof. Mennig
2006-03-31 Dimitrova, Krassimira Georgieva
Thermische Effekte im Kollektorfeld solarthermischer Anlagen
Betreuer: Prof. Platzer
2006-03-30 Wu (w), Jingyan
Systematische Untersuchung der Einflüsse von Temperaturdifferenzen auf den Reaktionsablauf in Rohrreaktoren
Betreuer: Prof. Platzer
2006-03-24 Auerbach, Peter
Zur Beanspruchung und Lebensdauer raumgängiger Gleitketten aus Kunststoffen
Betreuer: Prof. Nendel
2006-02-24 Rolle, Thomas
Die Entwicklung einer Technologie zur Herstellung von Verbundmaterial aus Getreidekleie
Betreuer: Prof. Nendel
2006-02-09 Lässig, Jörg
Gestaltungslösung für die Dienstleistungsfabrik Montage
Betreuer: Prof. Wirth
2006-01-27 Leiser, Jörg
Beitrag zu innovativen Verbindungstechniken für Hochleistungsverbundwerkstoffe
Betreuer: Prof. Köhler
2006-01-27 Friedrich, Frank
Beitrag zur Entwicklung von neuen Traglaschenketten in der Fördertechnik
Betreuer: Prof. Nendel
2006-01-26 Ohmann, Ulf
Aerobe Reinigung und anaerobe Entfärbung von Abwässern der Textilveredlungsindustrie
Betreuer: Prof. Platzer
2006-01-13 Kreißig, Udo
Entwicklung und Evaluation eines Beurteilungsverfahrens für handgehaltene, motorisch angetriebene Schlagwerkzeuge
Betreuer: Prof. Enderlein
2005-12-12 Chenping (m), Jia
Mikromechanischer Ultraschallwandler aus Silizium - Silicon Micromachines Ultrasonic Transducers
Betreuer: Prof. Hübler
2005-12-02 Todtermuschke, Marcel
Verfahrensoptimierung zur Herstellung einer punktförmigen, mechanisch gefügten, einseitig ebenen Verbindung ohne Verbindungselement
Betreuer: Prof. Matthes
2005-11-29 Yu (m), Du
Zur Optimierung des dynamischen Verhaltens von Gesamtfahrzeugen mit mechatronischen Komponenten
Betreuer: Prof. Maißer
2005-11-24 Hodic, Ludek
Entwicklung der Zeitdaten-Backend-Methode für die mathematische Verarbeitung betrieblicher Prozessdaten zu Planzeiten
Betreuer: Prof. Enderlein
2005-11-24 Günther, Uwe
Methodik zur Struktur- und Layoutplanung wandlungsfähiger Produktionssysteme
Betreuer: Prof. Wirth
2005-10-26 Riedel, Ralph
Heuristik zur Gestaltung ganzheitlicher Anreizsysteme aus soziotechnischer Sicht
Betreuer: Prof. Enderlein
2005-10-26 Hellfritzsch, Udo
Optimierung von Verzahnungsqualitäten beim Walzen von Stirnradverzahnungen
Betreuer: Prof. Neugebauer
2005-10-04 Kühnert, Ines
Grenzflächen beim Mehrkunststoff-Spritzgießen
Betreuer: Prof. Mennig
2005-09-29 Beckmann, Reinhold
Beitrag zur Auslegung und Konstruktion von Balligzahn-Kupplungen
Betreuer: Prof. Tenberge
2005-09-19 Dörffel, Claudia
Restabfallmengen aus privaten Haushalten in Sachsen - Entwicklung eines abfallwirtschaftlichen Simulations- und Prognosemodells
Betreuer: Prof. Platzer
2005-09-13 Sterzing, Andreas
Bewertung von Leichtbaupotential und Einsatzfähigkeit wölbstrukturierter Feinbleche
Betreuer: Prof. Neugebauer
2005-09-07 Scholta, Claudia
Erfolgsfaktoren unternehmensübergreifender Kooperation am Beispiel der mittelständischen Automobilzulieferindustrie in Sachsen
Betreuer: Prof. Enderlein
2005-08-26 Wenyong (m), Li
Aktive Dämpfung und Kompensation von Rotorschwingungen über aktive Piezo-Stapel-Aktuator-Lager
Betreuer: Prof. Maißer
2005-08-23 Hoyer, Ina
Beitrag zur Entwicklung von Hochtemperaturloten auf Eisenbasis
Betreuer: Prof. Wielage
2005-06-28 Wieland, Petra
Ein Beitrag zur Gestaltung der Spanentsorgung bei der Trockenbearbeitung
Betreuer: Prof. Neugebauer
2005-06-24 Schimanz, Barbara
Modellierung und experimenteller Nachweis von Zusammenhängen zwischen Parametern des Vernadelns, der Faseroberfläche und des Porenvolumens von dreideimensionalen Vliesstoffen
Betreuer: Prof. Köhler
2005-06-03 Neubauer, Werner
Gestaltung und Evaluation eines Mitarbeiter-Management-Informationssystems in der Montage eines Automobilwerkes
Betreuer: Prof. Enderlein
2005-05-26 Halle, Thorsten
Zusammenhänge zwischen Spanvorgängen und dem mechanischen Werkstoffverhalten bei hohen Dehnungsgeschwindigkeiten
Betreuer: Prof. Meyer
2005-05-25 Mücklich, Silke
Beitrag zum flussmittelfreien Löten von Magnesiumwerkstoffen mit angepassten Lötwerkstoffen
Betreuer: Prof. Wielage
2005-05-03 Freitag, Thomas
Entwicklung eines Natrium-Trihydrat Latentwärmespeichers mit einem Wärmeübertrager aus Kunststoffmetallverbund-Kapillarrohr
Betreuer: Prof. Platzer
2005-04-29 Olschewski, Torsten
Methode zur Gestaltung von flexibilitäts-stufenbasierten Fabrikplattformen
Betreuer: Prof. Wirth
2005-04-22 Bruzek , Bohumil
Untersuchungen zum Einfluss einer Passfederverbindung auf die Übertragungsfähigkeit von verzahnten dünnwandigen Naben
Betreuer: Prof. Leidich
2005-04-18 Hildebrand, Torsten
Theoretische Grundlagen der bausteinbasierten, technischen Gestaltung wandlungsfähiger Fabrikstrukturen nach dem Plug-Produce-Prinzip
Betreuer: Prof. Wirth
2005-03-16 Schulz, Rüdiger
Simulationsintegrierte Grobplanung von Montagesystemen für die Serienmontage am Beispiel der Automobilzulieferindustrie
Betreuer: Prof. Wirth
2005-03-04 Schultetus, Wolfgang
Praxisrelevanz arbeitswissenschaftlicher Erkenntnisse unter besonderer Berücksichtigung der Anforderungen an die produzierenden Unternehmen und des Nutzens hinsichtlich der Wirtschaftlichkeit
Betreuer: Prof. Enderlein
2005-02-18 Göppert, Stefan
Wärmeübertragung an einer ebenen Platte bei Anströmung durch instationäre Prallstrahlen
Betreuer: Prof. Platzer
2005-02-11 Lang, Heiko
Beitrag zum Fügen hochporöser metallischer Werkstoffe mittels prositätsbildender Zusatzwerkstoffe am Beispiel des Hartlötens von Aluminiumschaum
Betreuer: Prof. Matthes
2005-02-10 Hofbeck, Christoph
Entwicklung einer Methode für die Planung von Projekten unter Anwendung des kompetenzzellenbasierten Vernetzungsansatzes
Betreuer: Prof. Petermann
2005-02-07 Sager, Marion
Entwicklung einer Methodik zur Gestaltung von (flexiblen) Arbeitszeitsystemen
Betreuer: Prof. Enderlein
2005-01-24 Zimmer, Egbert
Bedienbarkeit von Fertigungseinrichtungen
Betreuer: Prof. Enderlein
2005-01-21 Lorenz, Ivo
Beitrag zu multifunktionalen Hohlfaser-Verbundsystemen
Betreuer: Prof. Köhler
2005-01-20 Lösel, Wolfgang
Methode zur Revitalisierung, Modernisierung und Umnutzung von Industriebrachen
Betreuer: Prof. Wirth
2004-12-23 Müller, Andreas
Singuläre Phänomene in der Kinematik von Starrkörpermechansimen - Mathematische Modellierung und lokale Analyse
Betreuer: Prof. Maißer
2004-12-14 Tassi, Endre
Knowledge-Features für die Produkt- und Technologieentwicklung in umformtechnischen Prozessketten
Betreuer: Prof. Neugebauer
2004-12-13 Müller, Markus
Beitrag zur Herstellung von Strukturen aus gerichteten Gelegen mit thermoplastischer Stapelfaserverstärkung
Betreuer: Prof. Köhler
2004-12-10 Kolbe, Gerald
Beitrag zur Erhöhung der Verschleißbeständigkeit von Bauteilen aus TiAl6V4-durch Dispergieren/Legieren mit Diboriden
Betreuer: Prof. Matthes
2004-10-29 Heinrich, Steffen
Operative technisch-organisatorische Planung und Steuerung der spanenden Teilefertigung mit holonischen Merkmalen
Betreuer: Prof. Dürr
2004-10-15 Sicre, Benoit
Nachhaltige Energieversorgung von Niedrigstenergiehäusern auf Basis der Kraft-Wärme-Kopplung im Kleinstleistungsbereich und der Solarthermie
Betreuer: Prof. Platzer
2004-10-11 Schmieder, Marcel
Untersuchung zur Übertragbarkeit der kompetenzzellenbasierten Vernetzungstheorie auf die variantenreiche Serienproduktion
Betreuer: Prof. Wirth
2004-10-04 Riedel , Frank
Habilitation!Möglichkeiten der Optimierung von punktförmigen, form- und kraftschlüssigen Feinblechverbindungen
Betreuer: Prof. Matthes
2004-09-22 Mehnert, Jens
Gestaltung und Integration von Arbeitsplanungskompetenzen für hierarchielose Produktionsnetze
Betreuer: Prof. Dürr
2004-07-23 Sedlacik, Gert
Beitrag zum Einsatz von unidirektionalnaturfaserverstärkten thermoplastischen Kunststoffen als Werkstoff für großflächige Strukturbauteile
Betreuer: Prof. Köhler
2004-07-20 Weiß, Uwe
Einsatz neuer Materialsysteme für Niedrigenergie Anzündelemente in Airbagsystemen
Betreuer: Prof. Wielage
2004-07-13 Steffani, Katharina
Mesoskopische Modellierung von Ausbreitungsmechanismen in Rohren und Kanälen zur Berechnung von Verweilzeitverteilungen
Betreuer: Prof. Platzer
2004-07-09 Pachler, Klaus
Parallele Berechnung 3-dimensionaler, instationärer Gas-Partikel-Strömungen unter Berücksichtigung von Kollissionen und Aggregatzuständen
Betreuer: Prof. Platzer
2004-07-05 Mahn, Uwe
Erweiterung der Einsatzgrenzen beim Spannen hochbelasteter, langgestreckter Werkstücke
Betreuer: Prof. Neugebauer
2004-06-28 Roßmann, Thomas
Entwicklung und Validierung eines Messverfahrens zur Bestimmung der Geruchsausbreitung im bodennahen Bereich
Betreuer: Prof. Platzer
2004-06-02 Schmeißer, Swen
Beitrag zu offenen Automatisierungsnetzen am Beispiel eines Web-basiserten Labors Automatisierungstechnik
Betreuer: Prof. Heß
2004-05-17 Thielen, Michael
Book-on-Demand: Entwicklung eines Konzepts zur Integration zur Buchweiterverarbeitung in einen digitalen Workflow
Betreuer: Prof. Hübler
2004-05-17 Zimniak, Joachim
Analyse von Grundprozessen der Aufbereitung von Kompositwerkstoffen aus ausgewählten Kunststoff- und Gummiabfällen
Betreuer: Prof. Mennig
2004-04-26 Schuster , Jochen
Theoretische Beschreibung der Heißrissanfälligkeit metallischer Werkstoffe unter besonderer Berücksichtigung hochlegierter Stähle und Nickellegierungen
Betreuer: Prof. Matthes
2004-04-23 Zhao (m), Xueyong
Simulation des dynamischen Verhaltens einer Windenergieanlage als mechatronisches System
Betreuer: Prof. Maißer
2004-04-15 Jurklies, Ines
Generierung und Bewertung von Prozessketten für den Werkzeug- und Formenbau
Betreuer: Prof. Dürr
2004-04-05 Urbaneck, Thorsten
Berechnung des thermischen Verhaltens von Kies-Wasser-Speichern
Betreuer: Prof. Platzer
2004-03-22 Zhang (m), Tong
Energieertrag und dynamische Belastungen in einer Windkraftanlage mit stufenlosem leistungsverzweigtem Getriebe bei aktiver Dämpfung
Betreuer: Prof. Tenberge
2004-01-19 Kader (m), Magdy Abd El
Application of Hot-melt Inkjet Processes for Imaging at Offset Printing Form Cylinder
Betreuer: Prof. Hübler
2004-01-09 Klose, Lutz
Einsatzplanung von Mehrpunktziehanlagen auf einfach wirkenden Pressen
Betreuer: Prof. Neugebauer
2003-07-01 Bergner , Andreas
Betreuer: Prof. Köhler
2002-12-06 Ziaei , Masoud
Betreuer: Prof. Leidich
2002-07-21 Frank , Thomas
Betreuer: Prof. Platzer
