Navigation

Inhalt Hotkeys

Promotionen

Promotionen 2009

09.01.2009 Fischer, Thomas
Erzeugung leitfähiger Strukturen auf benetzungsstrukturierten Polymeroberflächen
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
15.01.2009 Domes, Daniel
Untersuchungen zum Einsatz von unipolaren SiC Leistungshalbleiterbauelementen in Antriebsumrichtern
Promotion zum Dr.-Ing.
Fakultät für Elektrotechnik und Informationstechnik
16.01.2009 Leischnig, Steffen
Entwicklung standardisierter Abläufe zur Verbesserung der Prozesszuverlässigkeit von Fertigungsanlagen
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
19.01.2009 Marmann, Jochen
"Ansätze zur Erklärung des Unternehmenswerts durch immaterielle Werte"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
23.01.2009 Scharf, Ingolf
Synthesen und Reaktionen akzeptorsubstituierter Diallene
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
23.01.2009 Gugel, Denis
Ordnungsreduktion in der Mikrosystemtechnik
Promotion zum Dr.-Ing.
Fakultät für Elektrotechnik und Informationstechnik
26.01.2009 Mokhtar, Mohd Noriznan
Biocatalytic Production, Preparation and Characterization of Large-Ring Cyclodextrins
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
27.01.2009 Kausch, Jana
Im Studium geht fast nichts ohne die FDJ, aber alles mit ihr. Das hochschulpolitische Konzept der SED am Beispiel der Technischen Hochschule/Universität Karl-Marx-Stadt und die daraus resultierende Rolle der FDJ zwischen 1953 und 1989/90 (Promotionsfach Politikwissenschaft)
Promotion zum Dr.phil.
Philosophische Fakultät
27.01.2009 Apelt, Andreas H.
Die Opposition in der DDR und die deutsche Frage 1989/90 (Promotionsfach Politikwissenschaft)
Promotion zum Dr.phil.
Philosophische Fakultät
28.01.2009 Schmidt, Anja
"F&E-orientiertes strategisches Supply Chain Management - Erklärungs- und Gestaltungsbeiträge sowie deren Konkretisierung am Beispiel von Make-Cooperate-or-Buy-Entscheidungen"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
28.01.2009 Siemes, Annette
Zahlen in Medienangeboten - eine Studie zur Konstitution und Funktion medialer Zahlenwirklichkeiten. (Promotionsfach Medienkommunikation)
Promotion zum Dr.phil.
Philosophische Fakultät
29.01.2009 Wu, Senlin
Geometry of Minkowski Planes and Spaces - Selected Topics
Promotion zum Dr.rer.nat.
Fakultät für Mathematik
03.02.2009 Platzhoff, Elke
"Arbeitnehmerüberlassung und Legitimität"
Promotion zum Dr.jur.
Fakultät für Wirtschaftswissenschaften
03.02.2009 Höinghaus, Lars
Entwicklung einer Simulationsmethodik zur Optimierung des Kühlschmierstoffeinsatzes bei mehrstufigen Warmumformprozessen
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
04.02.2009 Röhr, Bianka
Fest und Kult in Lykaonien (Promotionsfach Geschichte)
Promotion zum Dr.phil.
Philosophische Fakultät
05.02.2009 Schäfer, Thomas
Determinants of Music Preference (Promotionsfach Psychologie)
Promotion zum Dr.rer.nat.
Philosophische Fakultät
05.02.2009 Bolick, Susanne
Integration von Prozessketten und Workflowmodellierung in PDM-Systemen
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
06.02.2009 Fröhlich, Nils
"Zur Aktualität der Arbeitswerttheorie. Theoretische und empirische Aspekte"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
06.02.2009 Ruff, Andreas
"Public Electronic Procurement"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
09.02.2009 Maschke, Heike
"Beurteilung und Steuerung der Wirtschaftlichkeit in der Freien Wohlfahrtspflege am Beispiel der Diakonischen Altenhilfe in Sachsen"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
11.02.2009 Menzel, Daniela
"Wechselwirkungen zwischen Strategie- und Lernfähigkeit von kleinen und mittelständischen Unternehmen"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
11.02.2009 Schlegel, Gert
Experimentelle Untersuchungen zu Farbfilmbildungsprozessen in Sprühfarbwerken von Offsetdruckmaschinen
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
16.02.2009 Fichtner, Andreas
Anomaler Transport in ungeordneten iterierten Abbildungen
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
17.02.2009 Dietrich, Axel Maximilian
Gestaltung intra-organisationaler Produktionsnetzwerke - Methodik zur Konfiguration und Bewertung unternehmensinterner Produktionsnetzwerke mit standortübergreifender Kooperation zwischen Entwicklung und Produktion
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
20.02.2009 Cumova, Denisa
"Asset Allocation Based on Shortfall Risk"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
02.03.2009 Rupprecht, Christian
Ganzheitliche Verfahrens- und Schichtoptimierung für das Hochgeschwindigkeitsdrahtflammspritzen
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
05.03.2009 Bahn, Volker
Implementierung der Mehrpunkt-Technologie in den Innenhochdruck-Blechumformprozess (IHB)
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
06.03.2009 Hänel, Thomas
Technologieentwicklung für die Herstellung patientenindividueller Knochenaufbauimplantate aus Beta-Tricalciumphosphat durch 3D-Printing
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
23.03.2009 Geißler, Lutz
Eine Analyse der Typik der Intelligenz-Strukturen bei ADHS-KIndern und Jugendlichen mittels HAWIK-III im Vergleich mit der Norm-Stichprobe. (Promotionsfach Psychologie)
Promotion zum Dr.phil.
Philosophische Fakultät
27.03.2009 Lehmann, Daniel
Elektrische und spektroskopische Charakterisierung von organischen Feldeffekttransistor-Strukturen
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
27.03.2009 Opitz, Andreas
Methodik zur Planung ganzheitlich prozesseffizienter Fertigungssysteme
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
07.04.2009 Jakob, Alexander
Synthese und Reaktionsverhalten von Übergangsmetallkomplexen sowie deren Verwendung in der Homogenen Katalyse und Metallabscheidung
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
14.04.2009 Lehmann, Maik
Entwicklung einer Methodik zur Gestaltung von handlungsleitenden Informationsprozessen in Fertigungsabläufen der variantenreichen Großserienfertigung
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
16.04.2009 Oestreich, Erik
"Konzeption eines Konfigurationssystems für die designbezogene Individualisierung ausgewählter Komponenten komplexer technischer Produkte - Am Beispiel der Automobilindustrie - "
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
16.04.2009 Tenholte, Dirk
Ein MEMS-Vakuumsensor nach dem Reibungsprinzip
Promotion zum Dr.-Ing.
Fakultät für Elektrotechnik und Informationstechnik
16.04.2009 Lässig, Jörg
Algorithms and Models for the Generation and Control of Competence Networks
Promotion zum Dr.-Ing.
Fakultät für Informatik
17.04.2009 Wießner, Sven
Kontinuierliche Herstellung von Legierungen aus Elastomerpartikeln und Polypropylen durch reaktive Aufbereitung in einem Gleichdralldoppelschneckenextruder
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
29.04.2009 Ebert, Andreas
Berücksichtigung der elastischen Werkzeugdeformation im Bereich der Massivumformung am Beispiel Gesenkschmieden
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
30.04.2009 Mack, Berthold
"Prozessoptimierung eines Campinggroßhandels in Beziehung zu kleinen und mittelständischen Caravan-Handelsbetrieben"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
04.05.2009 Ishtaiwi, Zakariyya Naim Yousef
Dendrimers Based on 1,4-Phenylene Units: Synthesis, Reaction Chemistry, Reactivity, Structure and Bonding
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
08.05.2009 Mischke, Michael
Multimodale Bedienkonzepte im Dualtask - ein Ansatz für komplexe Bedienaufgaben im Fahrzeug
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
13.05.2009 Spengler, Gerrit
"Strategie und Organisationsentwicklung: Konzeption und Umsetzung eines integrierten, dynamischen Ansatzes zum strategischen Management"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
14.05.2009 Winkler, Isabell
The Processing of Frequency and Duration (Die Verarbeitung von Häufigkeit und Zeit) (Promotionsfach Psychologie)
Promotion zum Dr.rer.nat.
Philosophische Fakultät
15.05.2009 Nebel, Silvio
Ein Beitrag zur experimentellen und numerischen Analyse zeitabhängiger Eigenschaften von DMS-Messstellen
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
20.05.2009 Nicolai, Anja
Amid- und esterfunktionalisierte Amine sowie deren Verwendung als Ionophore bzw. als Trägermaterialien in der Suzuki-Reaktion
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
20.05.2009 Meinecke, Johannes
Unterstützung der Evolution Föderativer Systeme im Web Engineering
Promotion zum Dr.-Ing.
Fakultät für Informatik
26.05.2009 Nickel, Daniela
Gefüge- und Eigenschaftscharakterisierungen unbeschichteter grobkörniger und ultrafeinkörniger sowie anodisch oxidierter Aluminiumlegierungen
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
27.05.2009 Reichelt, Karin
Erich Kästner im Fletcherschen Lehrerseminar Dresden - zu den pädagogischen, sozialen und ästhetischen Wirkungen auf sein literarisches Werk - eine deskriptive Studie zur historischen Grundlagenforschung (Promotionsfach Germanistik)
Promotion zum Dr.phil.
Philosophische Fakultät
05.06.2009 Marczewski, Dawid Adam
Membranes via particle assisted wetting
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
10.06.2009 Böttcher, Sebastian
Beitrag zur Planung stückzahlflexibler Fertigungssysteme
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
12.06.2009 Nieländer, Ulf
CHEOPS: Das Chemnitzer hybrid-evolutionäre Optimierungssystem
Promotion zum Dr.-Ing.
Fakultät für Informatik
15.06.2009 Klunkert, Gabriele
Schaustellungen und Volksbelustigungen auf Leipziger Messen des 19. Jahrhunderts. Eine wirtschafts- und sozialgeschichtliche Untersuchung. (Promotionsfach Geschichte)
Promotion zum Dr.phil.
Philosophische Fakultät
30.06.2009 Hofmann, Marcus
"Fallbasierte Speicherung und Wiederverwendung von Erfahrungswissen über die prozessbezogene Implementierung von Services in SAP® Enterprise-SOA"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
30.06.2009 Galletti, Michele
Polarimetrisches Wetterradar
Promotion zum Dr.-Ing.
Fakultät für Elektrotechnik und Informationstechnik
01.07.2009 Dubbert, Martin
Simulatoren in der Elektrotechnik-Ausbildung (Promotionsfach Fachdidaktik - Didaktik technischer Berufsfelder)
Promotion zum Dr.phil.
Philosophische Fakultät
01.07.2009 Escandón, René Fabricio Orellana
"Nachhaltigkeit und Interventionen - Veränderungspraxis in deutschen Unternehmen und die Nachhaltigkeitsfrage"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
06.07.2009 Tetyuev, Andrey
Bodenartunabhängige Bodenfeuchtemessung mittels Impedanzspektroskopie
Promotion zum Dr.-Ing.
Fakultät für Elektrotechnik und Informationstechnik
07.07.2009 Schubert, Thomas
Konvergenz oder Divergenz im sächsischen Landtagswahlkampf? Eine qualitative Längsschnittanalyse der Landtagswahlkämpfe von CDU, SPD und PDS 1990-2004 - unter besonderer Berücksichtigung des wirtschaftspolitischen Themenwahlkampfes (Promotionsfach Politikwissenschaft)
Promotion zum Dr.phil.
Philosophische Fakultät
07.07.2009 Prinz, Sebastian
Die programmatische Entwicklung der PDS (Promotionsfach Politikwissenschaft)
Promotion zum Dr.phil.
Philosophische Fakultät
07.07.2009 Khaddour, Mounib
Negativbaufbau im Rollenoffsetdruck
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
07.07.2009 Cavallo, Francesca
Strain driven architecture of Si-based nanomembranes
Promotion zum Dr.-Ing.
Fakultät für Elektrotechnik und Informationstechnik
08.07.2009 Sachse, Manuela
"Negative Kommunikationseffekte von Sportsponsoring und Ambush-Marketing - Eine empirische Analyse am Beispiel der Fußball-WM 2006™ -
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
08.07.2009 Ölcüm, Ipek
"Die Berücksichtigung sozialer Belange im öffentlichen Auftragswesen"
Promotion zum Dr.jur.
Fakultät für Wirtschaftswissenschaften
09.07.2009 Mihalovits, Martin
"Unterstützung der auftragsinitiierten Finanzplanung durch Erfahrungswissen"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
09.07.2009 Sonntag, Diana
"Financing international health-promoting public goods against AIDS - A supply-side approach"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
09.07.2009 Schieschke, Klaus
"Der Bedeutungswandel des Begriffs der "Ärgernis erregenden Darstellung" im deutschen Markenrecht unter dem Einfluss der gesellschaftlichen Entwicklung"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
10.07.2009 Hockauf, Matthias
Fließspannungsverhalten ultrafeinkörniger Aluminiumwerkstoffe unter besonderer Berücksichtigung der Dehnrate
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
14.07.2009 Steinhorst, Peter
Anwendung adaptiver FEM für piezoelektrische und spezielle mechanische Probleme
Promotion zum Dr.rer.nat.
Fakultät für Mathematik
15.07.2009 Zabel, Nicole
Zur Geschichte des Deutschen Pädagogischen Zentralinstituts der DDR. Eine institutionsgeschichtliche Studie. (Promotionsfach Pädagogik)
Promotion zum Dr.phil.
Philosophische Fakultät
16.07.2009 Reuter, Susann
Untersuchung von Entwicklungs- und Transferprozessen beim flüssigtonerbasierten ferroelektrischen Druckverfahren
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
16.07.2009 Bhusal, Dharma Raj
"Economic Crime. Law and Legal Practice in the context of Nepal"
Promotion zum Dr.jur.
Fakultät für Wirtschaftswissenschaften
16.07.2009 Funke, Susann
"Die Handymastensteuer - eine neue Einnahmequelle der Gemeinden?"
Promotion zum Dr.jur.
Fakultät für Wirtschaftswissenschaften
17.07.2009 Altemeyer-Bartscher, Martin
"On Federal Transfer and Incentives"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
03.08.2009 Roth, Nina
Kupfer- und Ruthenium-Precursoren: Synthese, Charakterisierung und deren Verwendung zur Abscheidung metallischer Schichten nach dem CVD-Verfahren
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
05.08.2009 Adámková, Lenka
Schrecklich fremd, dennoch anziehend (Skvorecky). Zum Bild des Rotarmisten in ausgewählten Texten der tschechischen und deutschen Nachkriegsliteratur. (Promotionsfach Germanistik)
Promotion zum Dr.phil.
Philosophische Fakultät
06.08.2009 Fiebig, Siegfried
Wandel zur flexiblen Fabrik - Konsequenzen für die Steuer- und Fördertechnik
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
07.08.2009 Bennis, Abdelali
Entwicklung einer kontaktfreien nichtdestruktiven Methode zur Messung von mechanischen und elastischen Eigenschaften von mikromechanischen Mehrschichtsystemen mit akustischen Oberflächenwellen
Promotion zum Dr.-Ing.
Fakultät für Elektrotechnik und Informationstechnik
11.08.2009 Decker, Silvio
Fullerene im Strahlungsgleichgewicht - Untersuchungen in einem Quadrupolspeicher
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
18.08.2009 Bolz, Ina
Chromophore Barbitursäure-Derivate als schaltbare opto-chemische Sensoren für Nukleinbasen und verwandte Verbindungen
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
14.09.2009 Popken, Anke
Drivers reliance on lane keeping assistance systems as a function of the level of assistance (Promotionsfach Psychologie)
Promotion zum Dr.rer.nat.
Philosophische Fakultät
18.09.2009 Mansfeld, Dirk
Synthese und Charakterisierung neuartiger Bismutsilanolate, Bismut-oxo-cluster und Bismutkoordinationspolymere
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
21.09.2009 Rudolph, Almut
Measures of Implicit Self-Esteem Psychometric Properties and the Prediction of Anxious, Self-Confident and Defensive Behavior. (Promotionsfach Psychologie)
Promotion zum Dr.rer.nat.
Philosophische Fakultät
21.09.2009 Penk, Enrico
Synthesen und Reaktionen neuer Brückenkopf-Azirine
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
25.09.2009 Saak, Jens
Efficient Numerical Solution of Large Scale Algebraic Matrix Equations in PDE Control and Model Order Reduction
Promotion zum Dr.rer.nat.
Fakultät für Mathematik
29.09.2009 Meva, Francois Eyaane
Synthese mehrkerniger Komplexe mit Oxamato und Oxamidato Liganden
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
02.10.2009 Rabelo, Balduino
Optimal Reactive Power Sharing with the Doubly-Fed Induction Generators in Wind Turbines
Promotion zum Dr.-Ing.
Fakultät für Elektrotechnik und Informationstechnik
15.10.2009 Winkler, Anders
Experimentelle und theoretische Untersuchungen zur kunststoffgerechten Auslegung von Zahnrädern
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
19.10.2009 Brade, Janine
Das Zeigen in der Pädagogik. Eine Untersuchung zur Logik des Zeigens als Grundlage des professionellen pädagogischen Handelns. (Promotionsfach Pädagogik)
Promotion zum Dr.phil.
Philosophische Fakultät
19.10.2009 Wendt, Uwe
"Erweiterung der didaktischen Metadatenbeschreibung für E-Learning Bausteine zur Verbesserung ihrer Wiederverwendung"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
23.10.2009 Dienel, Marco
Entwicklung und Analyse von Arrays mikromechanischer Beschleunigungssensoren
Promotion zum Dr.-Ing.
Fakultät für Elektrotechnik und Informationstechnik
29.10.2009 Schoor, Cornelia
Die Bedeutung von Motivation für Wissenserwerbsprozesse beim computerunterstützten kooperativen Lernen (Promotionsfach Psychologie)
Promotion zum Dr.rer.nat.
Philosophische Fakultät
29.10.2009 Kehr, Mirko
Aufbau eines Hochtemperaturviskosimeters und Messung der Viskosität von Schmelzen des Systems Aluminium-Nickel
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
11.11.2009 Knoll, Thomas Martin
Cross-Domain and Cross-Layer Coarse Grained Quality of Service Support in IP-based Networks
Promotion zum Dr.-Ing.
Fakultät für Elektrotechnik und Informationstechnik
11.11.2009 Siegert, Uwe
Silber(I)- und Kupfer(I) – Precursoren für CVD, ALD und Spin-Coating Prozesse
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
12.11.2009 Weinel, Miriam
Computer-Supported Groups: Coordination and Social Presence. (Promotionsfach Medienkommunikation)
Promotion zum Dr.phil.
Philosophische Fakultät
12.11.2009 Schley, Lennart
"Erfolgsfaktoren von Sanierungen - Eine kausalanalytische Untersuchung mit dem Partial Least Squares-Verfahren"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
12.11.2009 Felsl, Hans Peter
Silizium- und SiC-Leistungsdioden unter besonderer Berücksichtigung von elektrisch-thermischen Kopplungseffekten und nichtlinearer Dynamik
Promotion zum Dr.-Ing.
Fakultät für Elektrotechnik und Informationstechnik
19.11.2009 Ecorchard, Gael
Static Accuracy Enhancement of Redundantly Actuated Parallel Kinematic Machine Tools
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
20.11.2009 Kurscheid, Eva Marie
Zur Bereitstellung positiver Minutenreserve durch dezentrale Klein-KWK-Anlagen
Promotion zum Dr.-Ing.
Fakultät für Elektrotechnik und Informationstechnik
20.11.2009 Shaporin, Alexey
Eine Methode zur dynamischen Parameteridentifikation und Teststrukturen zur Charakterisierung von Mikrosystemen auf Waferebene
Promotion zum Dr.-Ing.
Fakultät für Elektrotechnik und Informationstechnik
24.11.2009 Kleimann, Thomas
Lebensrealismus. Die Geschichtsphilosophie Giovanni Battista Vicos. (Promotionsfach Philosophie)
Promotion zum Dr.phil.
Philosophische Fakultät
25.11.2009 Hackert, Matthias
Entwicklung und Simulation eines Verfahrens zum elektrochemischen Abtragen von Mikrogeometrien mit geschlossenem elektrolytischen Freistrahl
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
27.11.2009 Rank, Holger
Simulationsmodelle und Teststrukturen zur Bewertung des Einflusses der Aufbau- und Verbindungstechnik auf Funktionskennwerte mikromechanischer Beschleunigungssensoren
Promotion zum Dr.-Ing.
Fakultät für Elektrotechnik und Informationstechnik
01.12.2009 Hunger, Hans-Georg
"Eine wissenschaftliche Analyse von Rahmenbedingungen, Gestaltungsfeldern, Strategien und Auswirkungen der DRG-Anwendung in deutschen Krankenhäusern auf der Basis eines internationalen Benchmark"
Promotion zum Dr.rer.pol.
Fakultät für Wirtschaftswissenschaften
08.12.2009 Csetnek, Ernö Robert
Overcoming the failure of the classical generalized interior-point regularity conditions in convex optimization. Applications of the duality theory to enlargements of maximal monotone operators.
Promotion zum Dr.rer.nat.
Fakultät für Mathematik
11.12.2009 Kursawe, Ansgar
Partial Oxidation of Ethene to Ethylene Oxide in Microchannel Reactors
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
11.12.2009 Döring, Helke
Bewertung des Einsatzes von Mikrostrukturreaktoren mit Katalysatorbeschichtung für heterogen katalysierte Gasphasenreaktionen
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften
14.12.2009 Hartmann, Uwe
Erhöhung der Verschleißfestigkeit von aktiven Werkzeugelementen und von Gleitringdichtsystemen im elastomerverarbeitenden Maschinenbau durch Einsatz alternativer Werkstoffe und Technologien
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
14.12.2009 Halle, Thorsten - Habilitation
Ermittlung und Modellierung von Werkstoffkenndaten metallischer Werkstoffe bei hohen Dehnungsgeschwindigkeiten auf dem Fachgebiet: Werkstofftechnik/Werkstoffprüfung
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
14.12.2009 Knappe, Sebastian
"Marktabgrenzung im Bereich VoIP"
Promotion zum Dr.jur.
Fakultät für Wirtschaftswissenschaften
15.12.2009 Wözel, Margit
Grundlegende Untersuchungen zum Verhalten von Verschleißschutzschichten bei Beanspruchung auf Ermüdungsverschleiß
Promotion zum Dr.-Ing.
Fakultät für Maschinenbau
16.12.2009 Mende, Susann
Eine empirische Analyse über den Kompetenzverlust der Landesparlamente im Bereich der Gesetzgebung am Beispiel des Sächsischen Landtages. (Promotionsfach Politikwissenschaft)
Promotion zum Dr.phil.
Philosophische Fakultät
16.12.2009 Stirn, Andreas
Traumschiffe des Sozialismus. Die Geschichte der DDR-Urlauberschiffe 1953 bis 1990. (Promotionsfach Politikwissenschaft)
Promotion zum Dr.phil.
Philosophische Fakultät
17.12.2009 Plänitz, Philipp
ab initio Berechnung elektronischer Eigenschaften von Dielektrika für neuartige Gate-Isolator-Schichtsysteme zukünftiger MOSFETs
Promotion zum Dr.rer.nat.
Fakultät für Naturwissenschaften

Presseartikel